(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE134

PENCW_10.PE134       Location/Qualifiers
FT   CDS             join(311236..311849,311904..312720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671902"
FT                   /orf_name="Pc13g01340"
FT                   /product="Pc13g01340 protein"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAP91203.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI00018305D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P9"
FT                   /transl_table=1
FT                   /translation="MGTLLPGKPLTALARCTRPTSNVNASMALRFTSTLQAHAQAKTAT
FT                   SPSLPPLSVLPARVLLRSLLVSTISSKRVLPIPALSLMSFLSKPNRIWLFDVDRNPVLH
FT                   GILKTTFYNQFCAGENGAECRSTIREMKDMGFRGMILTYAAETVFDHSTQAQSGQGVAA
FT                   LKSENGDVAVEASVHCPSIEAWREGTVETIYMTEAEDYIAVKLTGAGAKVTEAFTAGEL
FT                   PPHQMMDALHEVCTKAKDRKVRILIDAESQHFQKGISRVAVELMRKYNRDGYAAIYNTY
FT                   QAYLKNTPATLANHLALANEDGFTLGLKLVRGAYMATDERSLIHDTKEDTDNAYNMIAQ
FT                   GALRKNIGEFGDKGARDFPSVNLFLASHNKESVVTAHELHKNRVMSGLPTVPVRFAQLH
FT                   GMSDEVSFSLLQMNDGDGTPEVYKCSTWGGMGECLAYLLRRAIENRDAVLRTDNEYRAL
FT                   KKEVFRRVKSVLSLSPSS"
     MGTLLPGKPL TALARCTRPT SNVNASMALR FTSTLQAHAQ AKTATSPSLP PLSVLPARVL        60
     LRSLLVSTIS SKRVLPIPAL SLMSFLSKPN RIWLFDVDRN PVLHGILKTT FYNQFCAGEN       120
     GAECRSTIRE MKDMGFRGMI LTYAAETVFD HSTQAQSGQG VAALKSENGD VAVEASVHCP       180
     SIEAWREGTV ETIYMTEAED YIAVKLTGAG AKVTEAFTAG ELPPHQMMDA LHEVCTKAKD       240
     RKVRILIDAE SQHFQKGISR VAVELMRKYN RDGYAAIYNT YQAYLKNTPA TLANHLALAN       300
     EDGFTLGLKL VRGAYMATDE RSLIHDTKED TDNAYNMIAQ GALRKNIGEF GDKGARDFPS       360
     VNLFLASHNK ESVVTAHELH KNRVMSGLPT VPVRFAQLHG MSDEVSFSLL QMNDGDGTPE       420
     VYKCSTWGGM GECLAYLLRR AIENRDAVLR TDNEYRALKK EVFRRVKSVL SLSPSS           476
//

If you have problems or comments...

PBIL Back to PBIL home page