(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE135

PENCW_10.PE135       Location/Qualifiers
FT   CDS             join(313975..314170,314228..314410,314472..315646)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824605"
FT                   /orf_name="Pc13g01350"
FT                   /product="Pc13g01350 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91204.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018305D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0"
FT                   /transl_table=1
FT                   /translation="MAPKLKGKSLSLIIGLVGAVGFVLQGYDQAVANGLLTLGSFIAVF
FT                   PQIDTVHTSGSEKSHNSTIQGTTVAIYEVGCALGAGSCAFLGDRLGRRKTIFLAGCVAL
FT                   VGVAIQASPFSLGQLIAGRVITGLGVGGFTATIPMYVSESSGAEARGRMVLLEGWFAIG
FT                   GIVLATWLEFGLYYVSDNSASWRFPIAFQGLFALVVVGCIMLLPESPRWLARVGRLEEA
FT                   SEVLARMENAPVDSEHVLQELEIIRQSLVIDDSTELAGSSSPFALTKNRHLHRTVIAVG
FT                   VNILAQMTGVNIITFYSDTIFESNLGYSGTLSRIITGCLQIWQFLAAGVAGLLIDRVGR
FT                   RPLLIAAAAGMTLAQACLAGLSSHLENRSAAGASLLFYFVALFCFPIGLFLVPFMYAAE
FT                   IAPLRTRAKVTAMAAAANWLFNFVLAEVSPVGFATIHWRYYIVYACISAFACVSFYFFC
FT                   PETKGRTLEEIDDIFVQSKSAFDTVRIAREMPYQTEILAHVSDTEKGGLEAMQVENASK
FT                   "
     MAPKLKGKSL SLIIGLVGAV GFVLQGYDQA VANGLLTLGS FIAVFPQIDT VHTSGSEKSH        60
     NSTIQGTTVA IYEVGCALGA GSCAFLGDRL GRRKTIFLAG CVALVGVAIQ ASPFSLGQLI       120
     AGRVITGLGV GGFTATIPMY VSESSGAEAR GRMVLLEGWF AIGGIVLATW LEFGLYYVSD       180
     NSASWRFPIA FQGLFALVVV GCIMLLPESP RWLARVGRLE EASEVLARME NAPVDSEHVL       240
     QELEIIRQSL VIDDSTELAG SSSPFALTKN RHLHRTVIAV GVNILAQMTG VNIITFYSDT       300
     IFESNLGYSG TLSRIITGCL QIWQFLAAGV AGLLIDRVGR RPLLIAAAAG MTLAQACLAG       360
     LSSHLENRSA AGASLLFYFV ALFCFPIGLF LVPFMYAAEI APLRTRAKVT AMAAAANWLF       420
     NFVLAEVSPV GFATIHWRYY IVYACISAFA CVSFYFFCPE TKGRTLEEID DIFVQSKSAF       480
     DTVRIAREMP YQTEILAHVS DTEKGGLEAM QVENASK                                517
//

If you have problems or comments...

PBIL Back to PBIL home page