(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE136

PENCW_10.PE136       Location/Qualifiers
FT   CDS             join(complement(316872..316996),complement(316096..316819))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948746"
FT                   /orf_name="Pc13g01360"
FT                   /product="Pc13g01360 protein"
FT                   /protein_id="CAP91205.1"
FT                   /db_xref="UniParc:UPI00018305D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q1"
FT                   /transl_table=1
FT                   /translation="MQHQIQNEARWSNPQLGQLAGDLAAAAASASLVTPAVAIIDRALV
FT                   EQAAFKQPIFCGLRRHALGALRQPGLFVFQRPFGIVWALYAATYSVANVTDTISRKLEI
FT                   TAAGAITFATTMLANVPLALWKDLRFAQEYGTGRGPDAKTSKATTPIPVPLQNKSLART
FT                   AAAIFLVRDGFTIFGSFTLAPWLSDAIPDSLAAHPQAKPIITQLTVPVLTQLVATPLHL
FT                   LALDMYTRQYTMPFLERVKHSQQYLPSSTLLRCVRIIPAFGIGCLTNMELRSAFHAKAS
FT                   G"
     MQHQIQNEAR WSNPQLGQLA GDLAAAAASA SLVTPAVAII DRALVEQAAF KQPIFCGLRR        60
     HALGALRQPG LFVFQRPFGI VWALYAATYS VANVTDTISR KLEITAAGAI TFATTMLANV       120
     PLALWKDLRF AQEYGTGRGP DAKTSKATTP IPVPLQNKSL ARTAAAIFLV RDGFTIFGSF       180
     TLAPWLSDAI PDSLAAHPQA KPIITQLTVP VLTQLVATPL HLLALDMYTR QYTMPFLERV       240
     KHSQQYLPSS TLLRCVRIIP AFGIGCLTNM ELRSAFHAKA SG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page