(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE137

PENCW_10.PE137       Location/Qualifiers
FT   CDS             join(317309..317449,317500..317972,318029..318978,
FT                   319037..319209)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671903"
FT                   /orf_name="Pc13g01370"
FT                   /product="Pc13g01370 protein"
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAP91206.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00018305D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q2"
FT                   /transl_table=1
FT                   /translation="MSTTLMRLRSARPTGSRLRSVPAGLSIQARAKATMPFRLPDGRNE
FT                   PNPLYKKGSPERAKVEEALTKLRSQLPVRSELFYDGKLQASSKSWDQPLPAEHATTFTN
FT                   YPFATDEQVRSAIELALEAKQSWQDTPFVDRASIFLKAAELVCTKYRYEIIAATMLGQG
FT                   KNIWQGEIDAAAELADFFRLNCNWAAEILEKQPTRGSDGMWSRIDYRPLEGFVYAVSPF
FT                   NFTAIGGNLICGPALMGNVVVWKPSASNVYASSLLYKILLEAGLPPNVIQFVTGDPEAI
FT                   TETVLSHRDFAGLNFIGSSDVFRSLYGKIGQGVAAKKYREFPRFVAETSGKNFHLVHPS
FT                   ADITSAVNHTIRGSFEYQGQKCSATSRLYLPESRAEEFLTQLKAGIKEITIGNPDKDLS
FT                   AFMGPVIHRGSFEKIKSVIDASNKDPSLKLIAGGTYDGSVGYYVHPTVYQADSPDHRLF
FT                   NEEIFGPVLAVHIYKDADWASTLKSVDQNGGGFALTGAVFAKDRIAIRQAEDALRYSAG
FT                   NFYINCKTTAALIGQQSFGGARASGTNDKAGSSDPLRRFVSPRLIKEEFFGQEGFTYPS
FT                   ND"
     MSTTLMRLRS ARPTGSRLRS VPAGLSIQAR AKATMPFRLP DGRNEPNPLY KKGSPERAKV        60
     EEALTKLRSQ LPVRSELFYD GKLQASSKSW DQPLPAEHAT TFTNYPFATD EQVRSAIELA       120
     LEAKQSWQDT PFVDRASIFL KAAELVCTKY RYEIIAATML GQGKNIWQGE IDAAAELADF       180
     FRLNCNWAAE ILEKQPTRGS DGMWSRIDYR PLEGFVYAVS PFNFTAIGGN LICGPALMGN       240
     VVVWKPSASN VYASSLLYKI LLEAGLPPNV IQFVTGDPEA ITETVLSHRD FAGLNFIGSS       300
     DVFRSLYGKI GQGVAAKKYR EFPRFVAETS GKNFHLVHPS ADITSAVNHT IRGSFEYQGQ       360
     KCSATSRLYL PESRAEEFLT QLKAGIKEIT IGNPDKDLSA FMGPVIHRGS FEKIKSVIDA       420
     SNKDPSLKLI AGGTYDGSVG YYVHPTVYQA DSPDHRLFNE EIFGPVLAVH IYKDADWAST       480
     LKSVDQNGGG FALTGAVFAK DRIAIRQAED ALRYSAGNFY INCKTTAALI GQQSFGGARA       540
     SGTNDKAGSS DPLRRFVSPR LIKEEFFGQE GFTYPSND                               578
//

If you have problems or comments...

PBIL Back to PBIL home page