(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE139

PENCW_10.PE139       Location/Qualifiers
FT   CDS             join(complement(323629..323840),complement(323481..323578),
FT                   complement(323273..323428),complement(322688..323226),
FT                   complement(322367..322637),complement(322141..322313),
FT                   complement(321895..322078),complement(321349..321842))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948748"
FT                   /orf_name="Pc13g01390"
FT                   /product="Pc13g01390 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91208.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018305D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q4"
FT                   /transl_table=1
FT                   /translation="MHTNNLVVHDAGDKRSNVPGHSHAMDAASERLVKMLHVSCLSLIS
FT                   SAYPGLSAKLSCIFDDRDQKILVTKGYIMELQQKIARIEQKEKGQASPFSSNFDTQTID
FT                   PKDRERVPTLERTSTPDDHNEPRELDDLDSELANPLSSGPPAFMSAANGRTFYLGTSSN
FT                   WSFTRRVLSLAHQHLYQDVLPTESLIFDETTYELGWDGLRTTPSLDFPVVPTRDHTMYL
FT                   INAVKFRCGQLYHLFEEDVFMSSLQQFYSGDGQSMTNSLWYIHFLLILAFGKGFVQPKA
FT                   QGRKPPGVSYFVKALQLLPDPTALYRDPTLGTEILCCIALYYQCVDFRTSAHNYIGQAM
FT                   RIAMAQGMHTSMPVEALGHDMVQRSGKIWWTIYILDREMTSLMGLPQSINDRYVQTQLP
FT                   TFADPSETMSLGMHIKLSQIIAEVNSTIYVINGRINRTFLLSTKTALANIAGLADELRE
FT                   SFPLYLDPGSGISRISAYLHLQYHQCIILATRPLLFCFLKIRFESPESCLESLNASRNV
FT                   RNLMQMCLESAQNIISILSSLQGQGLLETFLPFDLESVFVSTIILLMGPAIDPRVLESH
FT                   PNWLEKAYAIFDEMIRDGNQVAKFRRSELQQLHETLLGCISGDQPRQLAVPDFFQQADV
FT                   LPNPASPSVTPIPGAMPQSIRYDDALLRPDTDLDAECDFSTMLTSAEIMAVADSIESYD
FT                   TEWVSNAMVEHSIW"
     MHTNNLVVHD AGDKRSNVPG HSHAMDAASE RLVKMLHVSC LSLISSAYPG LSAKLSCIFD        60
     DRDQKILVTK GYIMELQQKI ARIEQKEKGQ ASPFSSNFDT QTIDPKDRER VPTLERTSTP       120
     DDHNEPRELD DLDSELANPL SSGPPAFMSA ANGRTFYLGT SSNWSFTRRV LSLAHQHLYQ       180
     DVLPTESLIF DETTYELGWD GLRTTPSLDF PVVPTRDHTM YLINAVKFRC GQLYHLFEED       240
     VFMSSLQQFY SGDGQSMTNS LWYIHFLLIL AFGKGFVQPK AQGRKPPGVS YFVKALQLLP       300
     DPTALYRDPT LGTEILCCIA LYYQCVDFRT SAHNYIGQAM RIAMAQGMHT SMPVEALGHD       360
     MVQRSGKIWW TIYILDREMT SLMGLPQSIN DRYVQTQLPT FADPSETMSL GMHIKLSQII       420
     AEVNSTIYVI NGRINRTFLL STKTALANIA GLADELRESF PLYLDPGSGI SRISAYLHLQ       480
     YHQCIILATR PLLFCFLKIR FESPESCLES LNASRNVRNL MQMCLESAQN IISILSSLQG       540
     QGLLETFLPF DLESVFVSTI ILLMGPAIDP RVLESHPNWL EKAYAIFDEM IRDGNQVAKF       600
     RRSELQQLHE TLLGCISGDQ PRQLAVPDFF QQADVLPNPA SPSVTPIPGA MPQSIRYDDA       660
     LLRPDTDLDA ECDFSTMLTS AEIMAVADSI ESYDTEWVSN AMVEHSIW                    708
//

If you have problems or comments...

PBIL Back to PBIL home page