(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE140

PENCW_10.PE140       Location/Qualifiers
FT   CDS             join(complement(325024..325753),complement(324242..324906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948749"
FT                   /orf_name="Pc13g01400"
FT                   /product="Pc13g01400 protein"
FT                   /protein_id="CAP91209.1"
FT                   /db_xref="UniParc:UPI00018305D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q5"
FT                   /transl_table=1
FT                   /translation="MSADLLAEFGQAPAPDNKSGQQPSQYQKNSFFGVDDNVDFFGSSG
FT                   SAQHNKPTHPNPGAVGQFATPAASCQRPSHQGFDLPLNPHSDVLFDAAFDTPASDDDWG
FT                   EFEGPDSNTQHEHSTALQHSMTATSQKPESWQDDPQGIKTIDLLDSLSVQDPVPVVKHP
FT                   SQIAKKEQQLEPTNSRAEPTWDDDSFDDWGDFADAPASQPLPKVSEKKTKPPTKPPTKP
FT                   LVKSNKPPASTWDDDAFDDWGAPAATVRPTNIPPPSVLLELFLDVFENLHKEAALAKSQ
FT                   LRSSAPPSSSSSNTVSTTALNIHNVLQSAARVIAGRSLRWKRDTILSQSMRIGPARSGK
FT                   AGGMKLNSVNKQENIKEEQDAVDVITTWRERAAVFNAVLQAAGLRPIPTVPDASALKVI
FT                   TARADQGALKASHPCALCSLKRDERVLRVDEQNVQDSFGEWWTEHWGHTACRQFWERNR
FT                   NLLGQR"
     MSADLLAEFG QAPAPDNKSG QQPSQYQKNS FFGVDDNVDF FGSSGSAQHN KPTHPNPGAV        60
     GQFATPAASC QRPSHQGFDL PLNPHSDVLF DAAFDTPASD DDWGEFEGPD SNTQHEHSTA       120
     LQHSMTATSQ KPESWQDDPQ GIKTIDLLDS LSVQDPVPVV KHPSQIAKKE QQLEPTNSRA       180
     EPTWDDDSFD DWGDFADAPA SQPLPKVSEK KTKPPTKPPT KPLVKSNKPP ASTWDDDAFD       240
     DWGAPAATVR PTNIPPPSVL LELFLDVFEN LHKEAALAKS QLRSSAPPSS SSSNTVSTTA       300
     LNIHNVLQSA ARVIAGRSLR WKRDTILSQS MRIGPARSGK AGGMKLNSVN KQENIKEEQD       360
     AVDVITTWRE RAAVFNAVLQ AAGLRPIPTV PDASALKVIT ARADQGALKA SHPCALCSLK       420
     RDERVLRVDE QNVQDSFGEW WTEHWGHTAC RQFWERNRNL LGQR                        464
//

If you have problems or comments...

PBIL Back to PBIL home page