(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE141

PENCW_10.PE141       Location/Qualifiers
FT   CDS             join(complement(328554..328657),complement(328039..328112),
FT                   complement(326589..327973))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948750"
FT                   /orf_name="Pc13g01410"
FT                   /product="Putative uncharacterized protein Pc13g01410 "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91210.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00018305D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q6"
FT                   /transl_table=1
FT                   /translation="MDLVGLYRKDGITPTTLPNFADLHPKSGTKDLLVIPSEDGWFVSD
FT                   FYLFHYLLSPKFPRPPNQIWLTCEDPSALVRKYHEYLHGNPKGDRRAVLDGERLPNILG
FT                   AGNVRVVPRIDLLERYLSTLREQAAEATRCEEHLVLLFFGHGTPAHGIEVGDSILHMKD
FT                   LRHLLQPMSSTTIFTTSCYSGGWLVCPDINQEQLNTTSITASGKDNESSSWTVSGSAGR
FT                   ASGSLAASAVLRCLIDAEDETQERTEHPTYLELSKSVYDCVKDMVTLGNSQQIYFSAEN
FT                   DEWETSYQPRLGLPLASYKDKWLSLRQVPPSPSPPSSTSSPELAKTGGRRLKRLKYLAE
FT                   EYFAAKPGPNEASPNIGLHNCLRSVLNGATYPKEKVDSLTETTTYRLGAMYEADYLREQ
FT                   IGLKFPSIFSMETPLAQIENESCNPELYTQTWSLLLKRKICTTPIGIRLHFPKPLQYLT
FT                   IALVESSTSWEMIQDQVEAMASKKKAWFRFIYRAWMGNRVAHDEGVMNSRRAFLEACKK
FT                   LKY"
     MDLVGLYRKD GITPTTLPNF ADLHPKSGTK DLLVIPSEDG WFVSDFYLFH YLLSPKFPRP        60
     PNQIWLTCED PSALVRKYHE YLHGNPKGDR RAVLDGERLP NILGAGNVRV VPRIDLLERY       120
     LSTLREQAAE ATRCEEHLVL LFFGHGTPAH GIEVGDSILH MKDLRHLLQP MSSTTIFTTS       180
     CYSGGWLVCP DINQEQLNTT SITASGKDNE SSSWTVSGSA GRASGSLAAS AVLRCLIDAE       240
     DETQERTEHP TYLELSKSVY DCVKDMVTLG NSQQIYFSAE NDEWETSYQP RLGLPLASYK       300
     DKWLSLRQVP PSPSPPSSTS SPELAKTGGR RLKRLKYLAE EYFAAKPGPN EASPNIGLHN       360
     CLRSVLNGAT YPKEKVDSLT ETTTYRLGAM YEADYLREQI GLKFPSIFSM ETPLAQIENE       420
     SCNPELYTQT WSLLLKRKIC TTPIGIRLHF PKPLQYLTIA LVESSTSWEM IQDQVEAMAS       480
     KKKAWFRFIY RAWMGNRVAH DEGVMNSRRA FLEACKKLKY                             520
//

If you have problems or comments...

PBIL Back to PBIL home page