(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE142

PENCW_10.PE142       Location/Qualifiers
FT   CDS             join(329148..329170,329222..329339,329395..329553,
FT                   329619..330136,330191..331613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948751"
FT                   /orf_name="Pc13g01420"
FT                   /product="Pc13g01420 protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91211.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00018305D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q7"
FT                   /transl_table=1
FT                   /translation="MRTIEETRKRWDILFSDNDTPSDLRAALQSEHGGNLCNDGLRSVC
FT                   WKAFLLFDGLDKSEWAPKLDESRDAYRALRDHFLKYIEHPDDLESTVDPLADDEQSPWQ
FT                   TLRHDETLRAEILQDVDRCLQENFFFQEPDTKSKLTDILFVYSKLNPDVGYRQGMHELL
FT                   APILWAVDRDSVKPNLEDLDANKDKSEGLMRKLLDAQFVEHDAFTLFLSVMQTARIYYE
FT                   HGETRSANGQMDVIPIVDRCHYLHKEALTIIDHELAEHLEAVDVLPQIFLTRWMRLLFG
FT                   REVPFDDVLTMWDLLFAHGLRSDLVDFTCIAMLLRIRWQCWSACSIFHRIFIADMHHLV
FT                   LTADYTTALTLLLRYPSPQPHTTQSFVHDALYLEQNPTADRGSFIISKYSGRPPDAKFR
FT                   QQPSTRPTRKAFLWEDFKKRSGSNSPTGSPARNSPNSLESLFQDVSQGIQRRTETWGVA
FT                   KAVRGAVTEARKNMQTMNFDPNMRPVSSRPISAASASDIQSKAPMASTVASARLETKIN
FT                   LLEKRNQALATMLREALDDLGSQLANIKDLGSDTNSAVKQALVKAESVQVCLGDSSIPV
FT                   DPPLDPRVDGELNQLDELQETVTSTMGKEDDNVVANEGQSRTINPVKADTTGPKAESGT
FT                   NPTLDTASRTNSDRKESARAIRSRPTVRPSMTDSGFSWMLGGGRNLSGFVSSTSPPPEQ
FT                   TRHLDQTRGKPKPNALFGLSGDDNLGPDSEHSELALYSLRGSRDPLSGTGPL"
     MRTIEETRKR WDILFSDNDT PSDLRAALQS EHGGNLCNDG LRSVCWKAFL LFDGLDKSEW        60
     APKLDESRDA YRALRDHFLK YIEHPDDLES TVDPLADDEQ SPWQTLRHDE TLRAEILQDV       120
     DRCLQENFFF QEPDTKSKLT DILFVYSKLN PDVGYRQGMH ELLAPILWAV DRDSVKPNLE       180
     DLDANKDKSE GLMRKLLDAQ FVEHDAFTLF LSVMQTARIY YEHGETRSAN GQMDVIPIVD       240
     RCHYLHKEAL TIIDHELAEH LEAVDVLPQI FLTRWMRLLF GREVPFDDVL TMWDLLFAHG       300
     LRSDLVDFTC IAMLLRIRWQ CWSACSIFHR IFIADMHHLV LTADYTTALT LLLRYPSPQP       360
     HTTQSFVHDA LYLEQNPTAD RGSFIISKYS GRPPDAKFRQ QPSTRPTRKA FLWEDFKKRS       420
     GSNSPTGSPA RNSPNSLESL FQDVSQGIQR RTETWGVAKA VRGAVTEARK NMQTMNFDPN       480
     MRPVSSRPIS AASASDIQSK APMASTVASA RLETKINLLE KRNQALATML REALDDLGSQ       540
     LANIKDLGSD TNSAVKQALV KAESVQVCLG DSSIPVDPPL DPRVDGELNQ LDELQETVTS       600
     TMGKEDDNVV ANEGQSRTIN PVKADTTGPK AESGTNPTLD TASRTNSDRK ESARAIRSRP       660
     TVRPSMTDSG FSWMLGGGRN LSGFVSSTSP PPEQTRHLDQ TRGKPKPNAL FGLSGDDNLG       720
     PDSEHSELAL YSLRGSRDPL SGTGPL                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page