(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE143

PENCW_10.PE143       Location/Qualifiers
FT   CDS             join(332793..333062,333092..333261,333323..336288,
FT                   336367..336617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128950"
FT                   /orf_name="Pc13g01430"
FT                   /product="Pc13g01430 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91212.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018305DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q8"
FT                   /transl_table=1
FT                   /translation="MGLGELVEVRSKEPGHHLTRIELTTHRALRKEGLGEQPGRESIFS
FT                   QAITATRQHMPGYASDRRDQLLDHLEASHFLGRPVKWKPRDAPIEVNLADQNLGEPSPL
FT                   SSPLGPLSESPESESGLHHLSLQTDRLRSSAGSVSSGYDPLSRSPLFENDHGIGPSGLD
FT                   RIRHNQPSRVLTLPNMSTSSLSLGPIPSQRPVPSPRSRSSSRAHTGHLSNRSFTDLEDL
FT                   HRFPLESLHSFSFAQQSEEFLHSRQNILKRSIDFMRDRMGWAASNAAIANAQANASGDT
FT                   EMQGMMELLARANMLETQENQIQGRGPITGPAEINGDNIFEKAFSDADSSPVSTRGGVQ
FT                   DSIPSGSHPSDGSQLLSPVPSDSISNQRRDLVSAPTSRRVSLKRTYTDLCSVSVRSKLM
FT                   ETLAQPYTSSADPFASLNSSTAGLGFQIPAPHAHSNKWTPASQAVFRTEAKEPWTILAA
FT                   NDLSCLIFGVLQSEVRRLSILEVVQKEHREWLKAKLRDPSTDAAARMPLQPERANISAV
FT                   NPKFRGLGNGVTAQLLSKPSSREKSRRAQTDDGYGSSTRNTRNNNHPANKSRGVLLCGD
FT                   VVPIQKRNGSRGSASVWVMEKRGGLIWVLEEITENVASIQCDDSWNVVSAKGAVEKIWG
FT                   PSVVQKGQSITDLLPCLPSDSLETSLEKGLAKIVELKHFAARTAAGVCIPVAVGKGEGD
FT                   RTLQVSSFPHVAGMMVLSSSSLNVISSNSVFSSVLFGQQRPEGLHITQLVPDFDEILDV
FT                   LTEEDNVPLVDGIVIPEHSFRRARTLSILRDGKANAASVFTEPSGLLAKHRDGSTIVVD
FT                   IQLRVVKSGTLFSKDKAEKSSDRSSDSDDSDDTIAVTELVYALWITYSRQLHAAGPAAG
FT                   LSPSSVPSSKPTSPTHDPDSVRPSDASAATQTADNSKAYVEIQTPTSTLSQQLSEAASE
FT                   PLAARPAQPVPPVSAANAKNDPPAKRTINDYVILEEMGQGAYGQVKLARLKKQPNKKMV
FT                   LKFVTKKRILVDTWTRDRRLGTVPLEIHVLDFLRRDGLKHPNIVEMEGFFEDDINYYIE
FT                   MTPHGLPGMDLFDYIELKANMDESECQNIFKQVASAVNHLHTKALVVHRDIKDENVVLD
FT                   GEGRIKLIDFGSAAYIKNGPFDVFVGTIVLQGRSYRGKEQDIWALGILLYTIVYKENPF
FT                   YNVDEILDHPLRIPFLPFSEDCIDLIRTMLDRDVDNRLTITEVLEHPWMVGA"
     MGLGELVEVR SKEPGHHLTR IELTTHRALR KEGLGEQPGR ESIFSQAITA TRQHMPGYAS        60
     DRRDQLLDHL EASHFLGRPV KWKPRDAPIE VNLADQNLGE PSPLSSPLGP LSESPESESG       120
     LHHLSLQTDR LRSSAGSVSS GYDPLSRSPL FENDHGIGPS GLDRIRHNQP SRVLTLPNMS       180
     TSSLSLGPIP SQRPVPSPRS RSSSRAHTGH LSNRSFTDLE DLHRFPLESL HSFSFAQQSE       240
     EFLHSRQNIL KRSIDFMRDR MGWAASNAAI ANAQANASGD TEMQGMMELL ARANMLETQE       300
     NQIQGRGPIT GPAEINGDNI FEKAFSDADS SPVSTRGGVQ DSIPSGSHPS DGSQLLSPVP       360
     SDSISNQRRD LVSAPTSRRV SLKRTYTDLC SVSVRSKLME TLAQPYTSSA DPFASLNSST       420
     AGLGFQIPAP HAHSNKWTPA SQAVFRTEAK EPWTILAAND LSCLIFGVLQ SEVRRLSILE       480
     VVQKEHREWL KAKLRDPSTD AAARMPLQPE RANISAVNPK FRGLGNGVTA QLLSKPSSRE       540
     KSRRAQTDDG YGSSTRNTRN NNHPANKSRG VLLCGDVVPI QKRNGSRGSA SVWVMEKRGG       600
     LIWVLEEITE NVASIQCDDS WNVVSAKGAV EKIWGPSVVQ KGQSITDLLP CLPSDSLETS       660
     LEKGLAKIVE LKHFAARTAA GVCIPVAVGK GEGDRTLQVS SFPHVAGMMV LSSSSLNVIS       720
     SNSVFSSVLF GQQRPEGLHI TQLVPDFDEI LDVLTEEDNV PLVDGIVIPE HSFRRARTLS       780
     ILRDGKANAA SVFTEPSGLL AKHRDGSTIV VDIQLRVVKS GTLFSKDKAE KSSDRSSDSD       840
     DSDDTIAVTE LVYALWITYS RQLHAAGPAA GLSPSSVPSS KPTSPTHDPD SVRPSDASAA       900
     TQTADNSKAY VEIQTPTSTL SQQLSEAASE PLAARPAQPV PPVSAANAKN DPPAKRTIND       960
     YVILEEMGQG AYGQVKLARL KKQPNKKMVL KFVTKKRILV DTWTRDRRLG TVPLEIHVLD      1020
     FLRRDGLKHP NIVEMEGFFE DDINYYIEMT PHGLPGMDLF DYIELKANMD ESECQNIFKQ      1080
     VASAVNHLHT KALVVHRDIK DENVVLDGEG RIKLIDFGSA AYIKNGPFDV FVGTIVLQGR      1140
     SYRGKEQDIW ALGILLYTIV YKENPFYNVD EILDHPLRIP FLPFSEDCID LIRTMLDRDV      1200
     DNRLTITEVL EHPWMVGA                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page