(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE144

PENCW_10.PE144       Location/Qualifiers
FT   CDS             join(complement(337523..337609),complement(337310..337431),
FT                   complement(337055..337160))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948752"
FT                   /orf_name="Pc13g01440"
FT                   /product="Putative uncharacterized protein Pc13g01440 "
FT                   /protein_id="CAP91213.1"
FT                   /db_xref="UniParc:UPI00018305DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9"
FT                   /transl_table=1
FT                   /translation="MPFSWYFLSASWVTLEYIVQYTLVSVYETNPLKAPIQGHPRGQVP
FT                   ERQVRFIFASFGLPRCPGVFAGGGIIPNCIELERSGEAQLLNLAYKVELGPIVMQTKPH
FT                   "
     MPFSWYFLSA SWVTLEYIVQ YTLVSVYETN PLKAPIQGHP RGQVPERQVR FIFASFGLPR        60
     CPGVFAGGGI IPNCIELERS GEAQLLNLAY KVELGPIVMQ TKPH                        104
//

If you have problems or comments...

PBIL Back to PBIL home page