(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE146

PENCW_10.PE146       Location/Qualifiers
FT   CDS             join(complement(344712..345261),complement(343659..344660),
FT                   complement(343512..343604),complement(342185..343461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977832"
FT                   /orf_name="Pc13g01460"
FT                   /product="Pc13g01460 protein"
FT                   /protein_id="CAP91215.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018306A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R1"
FT                   /transl_table=1
FT                   /translation="MESAIRWSPTSSATEQRFLSVDVTGKSFRLCKVTGFDGNYIRHEV
FT                   LSTLSNVPGFRAFDWSTSNENLIAVGQSSGEATILRLDGDAKESLSFPVRNQRYCNAVA
FT                   FSTHGLVASGLDRVRNDFCLNIWDVNQRLSPAGGSRGFTEPLRKLASSEPITSIKFFRD
FT                   QPDTIVTGVKGQFVRIYDLREGPGNPSLQFPTRCVHNLAIDWLDENYIASCIPSNESTI
FT                   CVWDRRVGSRLTSPSMGSSASVADSGQATPALELKNVFHPKSSIWSLRFSRTNRGSLAA
FT                   LSSNGHFKNYDIAKDYLPEEYRSSIDETLGQGSSRNYPESVYTKHVRDVCVPFDNPTRS
FT                   YKEKDRVVCFDSLNLSLSPQPSAIALDGNGQPQIITARPPCAPVDLSSRSVLACGISSS
FT                   DSDVRSIHPLSEHISPISDLIGNIRSRVCSTSQEHGANSNGQLFVSKNLGFEPVPSHEN
FT                   RERVMALGVMGVPLTAKEALTLCTINQSRCKEGYLFDEARNRKVASDDQALQDFWGWVE
FT                   RARVGSSGTSMVVNGLDLNYLGVNSVWNNDLGKGFEQRCISAKKDDAKTVADAVATLAT
FT                   QLNLPETKGCDTAYPDHRRLCLRLCGATQSYRELEESVKNLSSEDQHTKAAALAVFQDE
FT                   PKLAYLGLRSNNPTQAHKLLAMAIAGASKGDNGTDWEDTCAEIAKELTDPYARAILALV
FT                   SKGDWNAVIKETTLPLKYRVEVALRWLPDDELTEYLKDATSQAIRQGDIEGVVLTGLGH
FT                   LAMGLFQSYIGKFNDVQTPVLAMSHTVPRFISNEKHIVQFEAWRETYRRQMNSWKLQLE
FT                   RARFDVGSRRFAVTADGRKLMPPPPQQVSLTCNYCTSPLTQHDASSQISPSTKSAEHVH
FT                   PTTGNPLAPTVMSGTVCPRCGRHMPRCGVCTLWLGSPDPMSRASIAADAEAGSREPTET
FT                   EVMRRFVVFCIHCNHGFHANHASDWFKRHKICPVAECNCICDR"
     MESAIRWSPT SSATEQRFLS VDVTGKSFRL CKVTGFDGNY IRHEVLSTLS NVPGFRAFDW        60
     STSNENLIAV GQSSGEATIL RLDGDAKESL SFPVRNQRYC NAVAFSTHGL VASGLDRVRN       120
     DFCLNIWDVN QRLSPAGGSR GFTEPLRKLA SSEPITSIKF FRDQPDTIVT GVKGQFVRIY       180
     DLREGPGNPS LQFPTRCVHN LAIDWLDENY IASCIPSNES TICVWDRRVG SRLTSPSMGS       240
     SASVADSGQA TPALELKNVF HPKSSIWSLR FSRTNRGSLA ALSSNGHFKN YDIAKDYLPE       300
     EYRSSIDETL GQGSSRNYPE SVYTKHVRDV CVPFDNPTRS YKEKDRVVCF DSLNLSLSPQ       360
     PSAIALDGNG QPQIITARPP CAPVDLSSRS VLACGISSSD SDVRSIHPLS EHISPISDLI       420
     GNIRSRVCST SQEHGANSNG QLFVSKNLGF EPVPSHENRE RVMALGVMGV PLTAKEALTL       480
     CTINQSRCKE GYLFDEARNR KVASDDQALQ DFWGWVERAR VGSSGTSMVV NGLDLNYLGV       540
     NSVWNNDLGK GFEQRCISAK KDDAKTVADA VATLATQLNL PETKGCDTAY PDHRRLCLRL       600
     CGATQSYREL EESVKNLSSE DQHTKAAALA VFQDEPKLAY LGLRSNNPTQ AHKLLAMAIA       660
     GASKGDNGTD WEDTCAEIAK ELTDPYARAI LALVSKGDWN AVIKETTLPL KYRVEVALRW       720
     LPDDELTEYL KDATSQAIRQ GDIEGVVLTG LGHLAMGLFQ SYIGKFNDVQ TPVLAMSHTV       780
     PRFISNEKHI VQFEAWRETY RRQMNSWKLQ LERARFDVGS RRFAVTADGR KLMPPPPQQV       840
     SLTCNYCTSP LTQHDASSQI SPSTKSAEHV HPTTGNPLAP TVMSGTVCPR CGRHMPRCGV       900
     CTLWLGSPDP MSRASIAADA EAGSREPTET EVMRRFVVFC IHCNHGFHAN HASDWFKRHK       960
     ICPVAECNCI CDR                                                          973
//

If you have problems or comments...

PBIL Back to PBIL home page