(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE147

PENCW_10.PE147       Location/Qualifiers
FT   CDS             join(345529..345943,346009..346589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977833"
FT                   /orf_name="Pc13g01470"
FT                   /product="Pc13g01470 protein"
FT                   /protein_id="CAP91216.1"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI00018306A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R2"
FT                   /transl_table=1
FT                   /translation="MSTDTRNQIDQSAPSKRKTRDGSEEVPPARKKVHRKANKADDQAQ
FT                   FVDFSKGDAAKPKVTRQFKDKFAPKPEKEYPSINDLKKRIRDVKRLLNKVDLPADARIL
FT                   QERALAGYEQDLADETARRERSSLIKKYHFVRFLDRKTATKELNRLTRREKEDLDSKQK
FT                   ARLAAKIHNCRVNLNYTIYYPLTEKYIALYPNGKHDTTDPESELQKQETKSNDAKPPLW
FT                   SVVEKCMEEKTLDLLREGKLYINANGEKIQSSSSGATTAANSQKEQSKKKEQKKETKAA
FT                   TQKDKYVSKDDKKSSKKEKTARNEKASKQHEASQQPNAEDEDDSDGGFFE"
     MSTDTRNQID QSAPSKRKTR DGSEEVPPAR KKVHRKANKA DDQAQFVDFS KGDAAKPKVT        60
     RQFKDKFAPK PEKEYPSIND LKKRIRDVKR LLNKVDLPAD ARILQERALA GYEQDLADET       120
     ARRERSSLIK KYHFVRFLDR KTATKELNRL TRREKEDLDS KQKARLAAKI HNCRVNLNYT       180
     IYYPLTEKYI ALYPNGKHDT TDPESELQKQ ETKSNDAKPP LWSVVEKCME EKTLDLLREG       240
     KLYINANGEK IQSSSSGATT AANSQKEQSK KKEQKKETKA ATQKDKYVSK DDKKSSKKEK       300
     TARNEKASKQ HEASQQPNAE DEDDSDGGFF E                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page