(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE148

PENCW_10.PE148       Location/Qualifiers
FT   CDS             complement(347926..349626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948754"
FT                   /orf_name="Pc13g01480"
FT                   /product="Putative uncharacterized protein Pc13g01480 "
FT                   /protein_id="CAP91217.1"
FT                   /db_xref="UniParc:UPI00018306A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R3"
FT                   /transl_table=1
FT                   /translation="MACTVSGETAFIKQQEILRDRCSKALADHLKENPDVVWTPKDGRG
FT                   ERPSSSEEAAKLKLVVDVEFDEETGQPDFPPGNNRLSDELVYLVTKFMNARDLGRRYPY
FT                   DFDKMGNINPQRVPSGPAPIIWAHGLPFFPVYKGYYILCGRAHAGCIGWLLHEKTGEIM
FT                   QANPIWSVGAVVAPDSAVKAPRNITRQMTQHKPSGSEKNPGYRGKAWARDVVAAEHHLC
FT                   AVFPNLDSDEIEVCPMWNSWGYNVRCGPMRSGVKPTTMPKDFFTSHGIKNIDYESLARP
FT                   YGNHLMDEDEDSDDKDDPDGDVEVIDRAGESVEDASGSNQPIMTQSASQMDVDMNLVSL
FT                   LEVTKQVPAQSPGQHQEQVPEEQDAVRAPVQSPAAAAEKIKEGVKENVKEEAKEEVNEE
FT                   AMEKAIEVPVKQVTEETAKDSEIAPSDLEEKQLAVSNSTVDTELAMMTNIGDSIEQSNE
FT                   NPAPEQTSTAPVLLAETTIQATAIVQPIEVQPKIKQSEIEHAVTGTSDDNTHTIEPLKV
FT                   EQIAPDQPGTEQLDQTAASVLPEDLKVAGVPASNKTDASRSQAPAEVPM"
     MACTVSGETA FIKQQEILRD RCSKALADHL KENPDVVWTP KDGRGERPSS SEEAAKLKLV        60
     VDVEFDEETG QPDFPPGNNR LSDELVYLVT KFMNARDLGR RYPYDFDKMG NINPQRVPSG       120
     PAPIIWAHGL PFFPVYKGYY ILCGRAHAGC IGWLLHEKTG EIMQANPIWS VGAVVAPDSA       180
     VKAPRNITRQ MTQHKPSGSE KNPGYRGKAW ARDVVAAEHH LCAVFPNLDS DEIEVCPMWN       240
     SWGYNVRCGP MRSGVKPTTM PKDFFTSHGI KNIDYESLAR PYGNHLMDED EDSDDKDDPD       300
     GDVEVIDRAG ESVEDASGSN QPIMTQSASQ MDVDMNLVSL LEVTKQVPAQ SPGQHQEQVP       360
     EEQDAVRAPV QSPAAAAEKI KEGVKENVKE EAKEEVNEEA MEKAIEVPVK QVTEETAKDS       420
     EIAPSDLEEK QLAVSNSTVD TELAMMTNIG DSIEQSNENP APEQTSTAPV LLAETTIQAT       480
     AIVQPIEVQP KIKQSEIEHA VTGTSDDNTH TIEPLKVEQI APDQPGTEQL DQTAASVLPE       540
     DLKVAGVPAS NKTDASRSQA PAEVPM                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page