(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE149

PENCW_10.PE149       Location/Qualifiers
FT   CDS             join(351510..351668,351725..352594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824606"
FT                   /orf_name="Pc13g01490"
FT                   /product="Pc13g01490 protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="CAP91218.1"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI00018306AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R4"
FT                   /transl_table=1
FT                   /translation="MDHPKNNKDKRGRGQGQSRDVQVSKALSLLLRHAAEKEGLKMNTQ
FT                   GYASVSDVLNWRKLKSLKVTFPEILHAVDSSDKKRFALLHIPSAQPTKSTTQATTTPAT
FT                   SPDAEHEAGSIVGEEQPATSVLESAPTTSEAQQSATDQALSVKDTDPSNFLIRATQGHS
FT                   IKTVDAASFLEPLSLSDESKLPDTVVHGTFHATWPAILQSGGLRCMGRNHVHFATGPSL
FT                   ESVLAVNAEDAARSKPKPDDSRVISGMRRDAQVLIYIDVRKALKAGVPFWRSENGVILS
FT                   EGIPVTKGEAEKGEAQKFVTLDFFDVVVERKVGLGKIWEHGEVLQGLPETLTNKGNPKG
FT                   RR"
     MDHPKNNKDK RGRGQGQSRD VQVSKALSLL LRHAAEKEGL KMNTQGYASV SDVLNWRKLK        60
     SLKVTFPEIL HAVDSSDKKR FALLHIPSAQ PTKSTTQATT TPATSPDAEH EAGSIVGEEQ       120
     PATSVLESAP TTSEAQQSAT DQALSVKDTD PSNFLIRATQ GHSIKTVDAA SFLEPLSLSD       180
     ESKLPDTVVH GTFHATWPAI LQSGGLRCMG RNHVHFATGP SLESVLAVNA EDAARSKPKP       240
     DDSRVISGMR RDAQVLIYID VRKALKAGVP FWRSENGVIL SEGIPVTKGE AEKGEAQKFV       300
     TLDFFDVVVE RKVGLGKIWE HGEVLQGLPE TLTNKGNPKG RR                          342
//

If you have problems or comments...

PBIL Back to PBIL home page