(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE15

PENCW_10.PE15        Location/Qualifiers
FT   CDS             join(34416..34608,34783..34985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671647"
FT                   /orf_name="Pc13g00150"
FT                   /product="Pc13g00150 protein"
FT                   /protein_id="CAP91084.1"
FT                   /db_xref="UniParc:UPI0001830D01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G4"
FT                   /transl_table=1
FT                   /translation="MPPFILSKMPLKAVEHPSADDASSIYSRSPESPKDMLSSMPMMLP
FT                   PRHDLPEINSLDHQIALARVIDVSQELTLQYHFEPEARPLDNERVFQAVRKLRVALEQS
FT                   RIREAQAEQIWKRQWKVSRINHTTRWI"
     MPPFILSKMP LKAVEHPSAD DASSIYSRSP ESPKDMLSSM PMMLPPRHDL PEINSLDHQI        60
     ALARVIDVSQ ELTLQYHFEP EARPLDNERV FQAVRKLRVA LEQSRIREAQ AEQIWKRQWK       120
     VSRINHTTRW I                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page