(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE150

PENCW_10.PE150       Location/Qualifiers
FT   CDS             join(353298..353545,353612..354044,354099..354299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948755"
FT                   /orf_name="Pc13g01500"
FT                   /product="Pc13g01500 protein"
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91219.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI00018306AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R5"
FT                   /transl_table=1
FT                   /translation="MATHRFDPTFTDNVINAMGPKTTPRVRKLMAGLIRHMHDYAREEE
FT                   LTVDEWMAGVQMLNWAGQMSDDKRNEGQLVCDVLGLESLVDEITFTLAGEAQDAPTATA
FT                   ILGPFFRADTPYRENGEDIVKTKPADAEMAFMHGRVMDFQTKQPLVGATVEVWQASTNG
FT                   LYEQQDPEQVEFNLRGKFKTDEDGRYSFYCLRPTPYPVPNDGPGGKLLELMDRHPFRPA
FT                   HIHIIATYDNYRPLTTQIFDRKDKYLDNDSVFAVKDSLVVDFVPRKDDPKAAIELEYDV
FT                   KLVKFEASTGGA"
     MATHRFDPTF TDNVINAMGP KTTPRVRKLM AGLIRHMHDY AREEELTVDE WMAGVQMLNW        60
     AGQMSDDKRN EGQLVCDVLG LESLVDEITF TLAGEAQDAP TATAILGPFF RADTPYRENG       120
     EDIVKTKPAD AEMAFMHGRV MDFQTKQPLV GATVEVWQAS TNGLYEQQDP EQVEFNLRGK       180
     FKTDEDGRYS FYCLRPTPYP VPNDGPGGKL LELMDRHPFR PAHIHIIATY DNYRPLTTQI       240
     FDRKDKYLDN DSVFAVKDSL VVDFVPRKDD PKAAIELEYD VKLVKFEAST GGA              293
//

If you have problems or comments...

PBIL Back to PBIL home page