(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE151

PENCW_10.PE151       Location/Qualifiers
FT   CDS             join(complement(354910..355345),complement(354440..354816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671904"
FT                   /orf_name="Pc13g01510"
FT                   /product="Pc13g01510 protein"
FT                   /protein_id="CAP91220.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00018306AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R6"
FT                   /transl_table=1
FT                   /translation="MPFVQANSHRLNYADSHPDGPPTPNSLTFFFIHGLGSSQNYYYPV
FT                   IPHLTKLHRCITLDTYGSARSPYTDETVTLPGIAEDVIGVMDTLHIQKAVVVGHSMGGI
FT                   VVTELGARCPERIQGVVAIGPTHPSDTLVTVMNKRSETVLESGIEPMANTIPFGAVGSR
FT                   STPLQKAFIRELILGQDPKGYAALCRAIATAKPADYAAVKAPFLLIAGDEDKSASMEGC
FT                   QHIFHHISSEQKSLEVLKRVGHWHCIEAADEVGGLIAKFGDVLKAVNA"
     MPFVQANSHR LNYADSHPDG PPTPNSLTFF FIHGLGSSQN YYYPVIPHLT KLHRCITLDT        60
     YGSARSPYTD ETVTLPGIAE DVIGVMDTLH IQKAVVVGHS MGGIVVTELG ARCPERIQGV       120
     VAIGPTHPSD TLVTVMNKRS ETVLESGIEP MANTIPFGAV GSRSTPLQKA FIRELILGQD       180
     PKGYAALCRA IATAKPADYA AVKAPFLLIA GDEDKSASME GCQHIFHHIS SEQKSLEVLK       240
     RVGHWHCIEA ADEVGGLIAK FGDVLKAVNA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page