(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE153

PENCW_10.PE153       Location/Qualifiers
FT   CDS             join(complement(358072..358143),complement(358001..358011),
FT                   complement(357884..357941),complement(357644..357825),
FT                   complement(357058..357583))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128951"
FT                   /orf_name="Pc13g01530"
FT                   /product="Pc13g01530 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91222.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00018306AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R8"
FT                   /transl_table=1
FT                   /translation="MAPISLQSTYKLVSGYEIPVVGFGVYQTPSDVTEKVTRKAIELGY
FT                   RHVDSAKVYGNEKESAAAIRGSGLDRSKIFYTSKVPSKCMGYEKAKKAIEESIAAANLG
FT                   YIDLMLIHAPYGGKEDRLGTWRALVEAQKAGHVRSLGVSNFAIQHLEELEEYIKSGAGG
FT                   QITVGQYEIHPWCPREDIAEWLRKREIIVEAYSPLVQATRMKEPVLQNLAKKHGKTEAQ
FT                   ILVRWSLQKGYVPLPKSVTESRILENSQVFDFTLSDEDMASLQLNTYEPVCWDPVRDCK
FT                   I"
     MAPISLQSTY KLVSGYEIPV VGFGVYQTPS DVTEKVTRKA IELGYRHVDS AKVYGNEKES        60
     AAAIRGSGLD RSKIFYTSKV PSKCMGYEKA KKAIEESIAA ANLGYIDLML IHAPYGGKED       120
     RLGTWRALVE AQKAGHVRSL GVSNFAIQHL EELEEYIKSG AGGQITVGQY EIHPWCPRED       180
     IAEWLRKREI IVEAYSPLVQ ATRMKEPVLQ NLAKKHGKTE AQILVRWSLQ KGYVPLPKSV       240
     TESRILENSQ VFDFTLSDED MASLQLNTYE PVCWDPVRDC KI                          282
//

If you have problems or comments...

PBIL Back to PBIL home page