(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE154

PENCW_10.PE154       Location/Qualifiers
FT   CDS             join(358980..359057,359124..359612,359680..360324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948757"
FT                   /orf_name="Pc13g01540"
FT                   /product="Pc13g01540 protein"
FT                   /biological_process="translation"
FT                   /protein_id="CAP91223.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI00018306AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P1"
FT                   /transl_table=1
FT                   /translation="MRCIKNKIEHNGSGAVTLCPEEPEDMWHAYNLIRPDDILRASAIR
FT                   RVTTVQDTGSTSSARVHLNLVIRVKNLDFDPQSSQLHVSGQIINETPHTKIGQFHTLDL
FT                   ELNRNFTLEKEIGAGGEGVGWDSIAIESLKDAVDEGGKRRAEAVAVVMQEGLAHICFIG
FT                   QFQTILKQKIEMSVPRKRQGGGDHDKGMNKFFKVTLETLIRQMEFNTSLTSGANNEAVR
FT                   PVLLASPGFVASGFQKYIQSEASTTTPGLKRLLPSLVVVHSASGYTNSLSEVLQSPAVK
FT                   RLLADTKYARETKLMDDFLEQLRKETNKATYGPREVEDAVEQGAVGRGGGVLIVSNRLF
FT                   RSQDVAERKRWVALVDRVRDVEGGDVRILSSDHESGKRLEGLGGIAALLTFPVIEPDLD
FT                   SDAE"
     MRCIKNKIEH NGSGAVTLCP EEPEDMWHAY NLIRPDDILR ASAIRRVTTV QDTGSTSSAR        60
     VHLNLVIRVK NLDFDPQSSQ LHVSGQIINE TPHTKIGQFH TLDLELNRNF TLEKEIGAGG       120
     EGVGWDSIAI ESLKDAVDEG GKRRAEAVAV VMQEGLAHIC FIGQFQTILK QKIEMSVPRK       180
     RQGGGDHDKG MNKFFKVTLE TLIRQMEFNT SLTSGANNEA VRPVLLASPG FVASGFQKYI       240
     QSEASTTTPG LKRLLPSLVV VHSASGYTNS LSEVLQSPAV KRLLADTKYA RETKLMDDFL       300
     EQLRKETNKA TYGPREVEDA VEQGAVGRGG GVLIVSNRLF RSQDVAERKR WVALVDRVRD       360
     VEGGDVRILS SDHESGKRLE GLGGIAALLT FPVIEPDLDS DAE                         403
//

If you have problems or comments...

PBIL Back to PBIL home page