(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE155

PENCW_10.PE155       Location/Qualifiers
FT   CDS             join(complement(362106..362344),complement(361079..362027))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977834"
FT                   /orf_name="Pc13g01550"
FT                   /product="Pc13g01550 protein"
FT                   /protein_id="CAP91224.1"
FT                   /db_xref="UniParc:UPI00018306B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P2"
FT                   /transl_table=1
FT                   /translation="MSIILEDNQPPGFLRLGPTWYHEIPFLPHGWETTNDRGCGSLKHA
FT                   AMKAMLRDQSALKPELFEYVHWYMAEYLWDALKRCNKQTMHMWKIMASVYPVQFYKVSP
FT                   YYCLSAGCPKKPLRDYMGILNSEDFRWRAILTIATTYCTATDLTTIPNIKNLVALDVHN
FT                   EPYTSNNAPLHPVGVNNDGLLLQDGFVRGWIESKALRHLRILRFYHQHEMTVASLAALR
FT                   ELPELQLVVAYECKKITETIQKYDKPANGVIPVKGWSACRLDWFWENHGTSKTIDDNLL
FT                   ALHHVYQSSLQTPGEDSRRPSSLPTNLPILEFKLPTVDHSKRDRVVVRSRYNAKSIVLF
FT                   TRDPVKQKLDIKKQQRAREKKKRTEPPEKGDHPAKRAVMKERGPMDISETLNQFF"
     MSIILEDNQP PGFLRLGPTW YHEIPFLPHG WETTNDRGCG SLKHAAMKAM LRDQSALKPE        60
     LFEYVHWYMA EYLWDALKRC NKQTMHMWKI MASVYPVQFY KVSPYYCLSA GCPKKPLRDY       120
     MGILNSEDFR WRAILTIATT YCTATDLTTI PNIKNLVALD VHNEPYTSNN APLHPVGVNN       180
     DGLLLQDGFV RGWIESKALR HLRILRFYHQ HEMTVASLAA LRELPELQLV VAYECKKITE       240
     TIQKYDKPAN GVIPVKGWSA CRLDWFWENH GTSKTIDDNL LALHHVYQSS LQTPGEDSRR       300
     PSSLPTNLPI LEFKLPTVDH SKRDRVVVRS RYNAKSIVLF TRDPVKQKLD IKKQQRAREK       360
     KKRTEPPEKG DHPAKRAVMK ERGPMDISET LNQFF                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page