(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE156

PENCW_10.PE156       Location/Qualifiers
FT   CDS             join(complement(365274..365901),complement(363998..365220))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128952"
FT                   /orf_name="Pc13g01560"
FT                   /product="Pc13g01560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91225.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018306B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P3"
FT                   /transl_table=1
FT                   /translation="MQSFLQHRVLRRKLEQQFVTKHEKPENVWTHEGQYGYREGEIYTH
FT                   PRERSDDLAAERRREHGRRTFISGPSLQPRHSAASHLGREGDIEGAEYDPDLSTDPHTI
FT                   NSAETLGNTPDIMVTGVERPRPGFSTDSESDIESVKRNKLVVVTFEGEDDEMDPHNWTL
FT                   RRRMLVTLLTALMGCVIFWSSTIDTTALPKTRKVYHTSFEVQTLPTAMFLIGCGVGALI
FT                   TAPISEVIGRNPVYIPTMIGFMLFNTGAGLAQTIVQRVVCRGLAGFFGSAPAVLSAATL
FT                   VDVWSRIERVYAFPIYSIIIFIGPIVGPTPGSFAVDAESVSWRWVDWMTIIFAGLVLIP
FT                   VVLFLPESYSPILLYWKAQELRRLTGDDRYRSPLEFRKATFAHRLRASLYRPLLLFATE
FT                   PIILIHSVYLTVLFMILYTFLAGYVSIYHMASHFSPTSTALAFLGILVGVLLSLLILPI
FT                   SMWLLRREIYRSRRRGEHRPDPEISLYMAMFGAPAVPISLFWMGWTAELEFSYWSPLVA
FT                   SVFYGFGTVCIFVSGYQYVSDAFESHATSALSSLQMTRLVGAGAMVIVAEIMYTNLGVG
FT                   WTLTLWGCLSALFTPVPYLLYWRGYNLRQRSWYARRHEHD"
     MQSFLQHRVL RRKLEQQFVT KHEKPENVWT HEGQYGYREG EIYTHPRERS DDLAAERRRE        60
     HGRRTFISGP SLQPRHSAAS HLGREGDIEG AEYDPDLSTD PHTINSAETL GNTPDIMVTG       120
     VERPRPGFST DSESDIESVK RNKLVVVTFE GEDDEMDPHN WTLRRRMLVT LLTALMGCVI       180
     FWSSTIDTTA LPKTRKVYHT SFEVQTLPTA MFLIGCGVGA LITAPISEVI GRNPVYIPTM       240
     IGFMLFNTGA GLAQTIVQRV VCRGLAGFFG SAPAVLSAAT LVDVWSRIER VYAFPIYSII       300
     IFIGPIVGPT PGSFAVDAES VSWRWVDWMT IIFAGLVLIP VVLFLPESYS PILLYWKAQE       360
     LRRLTGDDRY RSPLEFRKAT FAHRLRASLY RPLLLFATEP IILIHSVYLT VLFMILYTFL       420
     AGYVSIYHMA SHFSPTSTAL AFLGILVGVL LSLLILPISM WLLRREIYRS RRRGEHRPDP       480
     EISLYMAMFG APAVPISLFW MGWTAELEFS YWSPLVASVF YGFGTVCIFV SGYQYVSDAF       540
     ESHATSALSS LQMTRLVGAG AMVIVAEIMY TNLGVGWTLT LWGCLSALFT PVPYLLYWRG       600
     YNLRQRSWYA RRHEHD                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page