(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE159

PENCW_10.PE159       Location/Qualifiers
FT   CDS             join(complement(373055..373100),complement(372806..372972),
FT                   complement(372397..372733),complement(371963..372335),
FT                   complement(371242..371903),complement(371064..371167))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948759"
FT                   /orf_name="Pc13g01590"
FT                   /product="Pc13g01590 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91228.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000183076F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R9"
FT                   /transl_table=1
FT                   /translation="MAFNGQTPTIVVLKEGTDASQGKGQIISNINACVAVQGTVKSTLG
FT                   PYGGDLLLVDANGRQTITNDGATVMKLLDIVHPAARILTDIARSQDAEVGDGTTSVVVL
FT                   AGEILKEVRDLVEQGVSSQTIIKGLRRASAMAVNKVKEIAVDMMDASVSQEKKVETLRR
FT                   LAATAMNSKLIKRNSDFFTKMVVDAVLSLDQDDLNERLIGVKKVTGGGLQDSLFVDGVA
FT                   FKKTFSYAGFEQQPKHFENPSIVCLNVELELKSEKDNAEVRVEQVSEYQAIVDAEWQII
FT                   FNKLEAIYKTGAKVVLSKLPIGDLATQYFADRDIFCAGRVASDDMDRVCQATGAATQST
FT                   CTDIQARHLGTCGAFEERQIGGERFNLFSDCPRAKTCTLVLRGGAEQFIAEVERSLHDA
FT                   IMIVKRALRNTTIVAGGGATEMELSSYMHGFADRNVPHKQQAVVKAFAKALEVIPRQLC
FT                   DNAGFDATDILNRLRVEHRKGNTWAGVDFDKEGVRDNMVAFVWEPSLVKVNAIQAAVEA
FT                   SCLILSVDETIKNEESAQPGQQRGMPPGAAQRALRGRGRGMPRRG"
     MAFNGQTPTI VVLKEGTDAS QGKGQIISNI NACVAVQGTV KSTLGPYGGD LLLVDANGRQ        60
     TITNDGATVM KLLDIVHPAA RILTDIARSQ DAEVGDGTTS VVVLAGEILK EVRDLVEQGV       120
     SSQTIIKGLR RASAMAVNKV KEIAVDMMDA SVSQEKKVET LRRLAATAMN SKLIKRNSDF       180
     FTKMVVDAVL SLDQDDLNER LIGVKKVTGG GLQDSLFVDG VAFKKTFSYA GFEQQPKHFE       240
     NPSIVCLNVE LELKSEKDNA EVRVEQVSEY QAIVDAEWQI IFNKLEAIYK TGAKVVLSKL       300
     PIGDLATQYF ADRDIFCAGR VASDDMDRVC QATGAATQST CTDIQARHLG TCGAFEERQI       360
     GGERFNLFSD CPRAKTCTLV LRGGAEQFIA EVERSLHDAI MIVKRALRNT TIVAGGGATE       420
     MELSSYMHGF ADRNVPHKQQ AVVKAFAKAL EVIPRQLCDN AGFDATDILN RLRVEHRKGN       480
     TWAGVDFDKE GVRDNMVAFV WEPSLVKVNA IQAAVEASCL ILSVDETIKN EESAQPGQQR       540
     GMPPGAAQRA LRGRGRGMPR RG                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page