(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE16

PENCW_10.PE16        Location/Qualifiers
FT   CDS             join(complement(36595..37270),complement(35597..36573))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671648"
FT                   /orf_name="Pc13g00160"
FT                   /product="Pc13g00160 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91085.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830D02"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G5"
FT                   /transl_table=1
FT                   /translation="MQQPKFLFPSILVLSVTIFYSWITKGIPSRLDANHAPKSRFELVR
FT                   VDSYDFPARAGGIDIIFVHGLGSNPDTTWGARRPQNPLNQTEPTPLNYEQYVNWVKEFL
FT                   PNDLPLEIRKDALYTRLPTIGNNLLEHIDRQIHRSKDEQSRCLIFVGHSYGGLVVKEGW
FT                   LLAYALQPLGSNPLILANLEYDAIQLRDLHEQFIASVRDDLQVVNYYEQRPIRLLKLWL
FT                   FQWQEFTVPESSATYDGKKVSKMGLPVNHYGLNKFESRSESYNSILSKLVKLVTPLLKP
FT                   AKHYYDVLVEIVQTFIQRDQVWEELEEKLQIRYDKASVLYAVTLHGLGGAGKSQLALKY
FT                   AESNTDRYNPILWIDITSEQTGIKKVIPKGTRGRIVITSRDDQSQKLVDRGCEQVRVNI
FT                   MSLREARMVLLRYLSDNIDLVLKTVQKDCDKVAKKLRYLPLAIDLADGLSSRADPYGEN
FT                   ASLGMPAIHNGLGEEDFTKLLILISDTEGEWDDFKYRQSIDVLVRYSLTQRVHGEWPGT
FT                   VMHSLVKWRITKEHYQPEFRQYLILYLPDARDINMTYISRMKIGDIFISTILARVLYDE
FT                   GRWQQAEQLLVQVIETRKAELGEEYPDTLNSIGSLASTFXNQGRWEEAEQLLVXVIETR
FT                   KAKLGEDHPDTLNSMSNLASTYLKQGRLEEAVQLGVQVIGTCKTKLGEDHPDTVYSMGN
FT                   LASTYRNQGWWEEAEXLKVQVMEIRKIKLGDDHPDTLNSMGNLASTFXNQGRXEEAEQL
FT                   LVQVIETRKAKLGEDYPDTLNSIRNLAATYLRQGRXEEAEELLVQVIETRKARLGEDHP
FT                   DTLNSISNLASTYLKGPLRGGRVGVQVIGTCKTKLGEDHPDTLTSISNLASIYRNQGRL
FT                   EEAEQLEIQVMEASKAKLGEDHPDTLSSVSNLAATYLTQGRWEEAEELRVQVIETRKAR
FT                   LGEDHPDTLNSMSNLAFTYRNQGRLEEAEQLEVQVMEASKAKLGADYPDTLNSMSNLAA
FT                   TYLTQGRWEEAEELGVQVIETRKAKLGEDHPDTLNSMGNLAATYLKQGRWEQVEQLLVQ
FT                   VMETHRAKLGEDHPDTLNSMANVASTWKFLGHDAKAIDLLRDCLTKQKQTFGQNHLTTL
FT                   SNSRTLLSWEMESPDYSKRYSKAIDLSTSVGIAAKRMRQAVVNERPGACKYYLQSHYK"
     MSTEIDELRR LLAEENEKTS KTNLPASLDG VHNHFFHGLA VQQDKTRYTR GDPATATNKL        60
     RPRRLKASGS FAKEQEDIXR LLMNSSLLFI PWKKLERHRG QLVGSELSLN RFLRQTVEDH       120
     VSKIIEELYS DPRLRQTFGL RGSIRFENHS NTLSPEWKLE ERMQNIDIRG RPRRSPRPAA       180
     REQSEPSTIM TRGRRTXAPA RSSRPRADQF CVYNNPQPII RIDPSLQISA XGDTGPHLXR       240
     AGGYGYXXGG XATRXXVPET SVPSRDCWTS CAATXLHYSC WYGNXGAKYR RSXYLSANWR       300
     IPGRFCTTSV PKGDVGDFTG WNPQSNGPNR LHFTAVGESL AFTLQALKLW PRHQAWRQKA       360
     IDSLPRREVV VAGILGSIXG GTVFQISATK DEWVTSNISD TTASQAKQAR CWWLPANRRT       420
     TRCRRGPIXP XYAEMGPTYM AQYQTGTANV NPYGTSTSFE GEGVSPVLLH VEVSTRNIEP       480
     GRARSGLPQC PXPWKGHHVI NATTCLKRLR RQLFQTVNAD CEVLGIHGSR GALLKVTLSR       540
     TDIMYLQNAP                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page