(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE161

PENCW_10.PE161       Location/Qualifiers
FT   CDS             join(375897..376709,376766..376779,376838..377646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948761"
FT                   /orf_name="Pc13g01610"
FT                   /product="Pc13g01610 protein"
FT                   /protein_id="CAP91230.1"
FT                   /db_xref="UniParc:UPI0001830771"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S1"
FT                   /transl_table=1
FT                   /translation="MSPKVTSRRALNSKLGIYVDXSGCDQNVSFRRTGWSPLSVFLIQV
FT                   SQFYCDRRAQILSTYAXDRIVFSRIFRGSTDATVFENFIAQLLALRKPVPKPVLVMDNA
FT                   SFRYSERIAHICVDVGVKLVYLPPYSPDLNPIQEFSAELKAFINDTKVVVNTDQGFITF
FT                   LGWCIDVVGAKEESAMGHFRHECLTIEAKGWK"
     MAERPQYFEN TLTPLSINTT TLFESLEKLR IAVHNGAELI QENTPLPETW GPNGIFRAFP        60
     GISKSSPTSQ PHNHLTTRLR NCSGIPTSRL SVLGARGSQS CLSXLSSLRT ATDSIKPSRH       120
     SSASLPIVSN WLIFACHCRH SARFRXSRKE XLARXRQCQH RKGGYRLPPR GHAVGTKERA       180
     SCYPXXPENG WRXDAVWPSR PSLGPFERSC SXLYSRDAGT PLACAGGNSX VDPSDCRCRA       240
     TRIQGIHRKE WSPRRTSIDV CMDGGSLLFR GGPRNNRYSN HPAFVXARRA YGLSSRDWWH       300
     YHCTLQAIWS YQWPPPNDTT SIXFQPALLG TSPAVSRQPW TVDSPRSCLE KRILNPRPLG       360
     SKLGPSHIHG HSACVGRRSS FXGRQFVSRR DWQCMGLAPA PXLFXIPLGY FERYPDSLSP       420
     AQXNINSSEC XNEPGAHXXL LPLEGTCIHV ACTXDXAIQH LAYIFRQRLS HAXXALQSVX       480
     RTCRQCLCLG XYMRVASSQA AQDRSCXAGC VGYIWFIARL GIPGCFPXTI GLSSPGWKWR       540
     NGSFL                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page