(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE162

PENCW_10.PE162       Location/Qualifiers
FT   CDS             join(377961..378150,378214..380636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948762"
FT                   /orf_name="Pc13g01620"
FT                   /product="Pc13g01620 protein"
FT                   /protein_id="CAP91231.1"
FT                   /db_xref="UniParc:UPI0001830772"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S2"
FT                   /transl_table=1
FT                   /translation="MDLIPPSYESATDRDAWTIIARYIPSSDLCAASLVCHRWHGLFMP
FT                   FLWGDPASHFGTDNDAVYVALTRFRRTLKYARQEVRALTHTIHLPPALSEIYGGPRPGW
FT                   LRDILECLPCLQCLMVSKLPFFDHHAMTALKTNERSSHYNIRLLLAEREPNTTSASLAQ
FT                   TLLLFPVLTYLDLSYTTPARDRNVLSTLAQMPFLRVLKLRGIGLKDNDAEFLADAIGQR
FT                   VRCLDLRDNMLTDIAICSLLQKSFLPTSERERQQSPRPATASPDPFSHSAINESDSDFF
FT                   KRPDLDEQFAKLLAQPVLFHPWVEDLPYMGITHLYITGNRISLEAVASLLRSSRLHALD
FT                   FGTIKPPDKAHHTHPYGKEEYPGAETLVPVLGKIAGDNLTYLRAHHAVLTGQPQTQDAV
FT                   SDDEFLPELSAQESLREVEQFELDASQQVYELSEETRPVFELADTSTTESTGSYSTTKG
FT                   LKTSQMLTAHEDEPTPSVRRGPAFAPEVVQPIPIHSSANGGTAFAVSRTGTWNTEQTEG
FT                   STLPSISMSLDCDKLATDFSLQATLQCSSPISTNDSLEQKVQELLSKRPRNQSIPLQGG
FT                   KESWFPYLHPSHIPHMESLVLTDVPSHVTPNSSILSALTRFITACSNEALLATLQAGSD
FT                   YSLPPGRARMQAEQQRSRSLFGLRRLILEITPVDSTKLTSWKPANQYNATGHSSTGDRD
FT                   SENLWSAAANDFSFFGEEECGVPENDPGKYFPMAVLNEKVSLMPMEDDSLHSPDSPRLG
FT                   RHLPRSPQTPGPPMTAEDRKQQCQASMIDLVAELAAFRRGKKAEYERVVRRERERRSTL
FT                   GTGASGLLMPSSPHISLSHYVEGHWKGEVKIVRNPVPKVRTGTVDMYGNYFEKGYLYP"
     MDLIPPSYES ATDRDAWTII ARYIPSSDLC AASLVCHRWH GLFMPFLWGD PASHFGTDND        60
     AVYVALTRFR RTLKYARQEV RALTHTIHLP PALSEIYGGP RPGWLRDILE CLPCLQCLMV       120
     SKLPFFDHHA MTALKTNERS SHYNIRLLLA EREPNTTSAS LAQTLLLFPV LTYLDLSYTT       180
     PARDRNVLST LAQMPFLRVL KLRGIGLKDN DAEFLADAIG QRVRCLDLRD NMLTDIAICS       240
     LLQKSFLPTS ERERQQSPRP ATASPDPFSH SAINESDSDF FKRPDLDEQF AKLLAQPVLF       300
     HPWVEDLPYM GITHLYITGN RISLEAVASL LRSSRLHALD FGTIKPPDKA HHTHPYGKEE       360
     YPGAETLVPV LGKIAGDNLT YLRAHHAVLT GQPQTQDAVS DDEFLPELSA QESLREVEQF       420
     ELDASQQVYE LSEETRPVFE LADTSTTEST GSYSTTKGLK TSQMLTAHED EPTPSVRRGP       480
     AFAPEVVQPI PIHSSANGGT AFAVSRTGTW NTEQTEGSTL PSISMSLDCD KLATDFSLQA       540
     TLQCSSPIST NDSLEQKVQE LLSKRPRNQS IPLQGGKESW FPYLHPSHIP HMESLVLTDV       600
     PSHVTPNSSI LSALTRFITA CSNEALLATL QAGSDYSLPP GRARMQAEQQ RSRSLFGLRR       660
     LILEITPVDS TKLTSWKPAN QYNATGHSST GDRDSENLWS AAANDFSFFG EEECGVPEND       720
     PGKYFPMAVL NEKVSLMPME DDSLHSPDSP RLGRHLPRSP QTPGPPMTAE DRKQQCQASM       780
     IDLVAELAAF RRGKKAEYER VVRRERERRS TLGTGASGLL MPSSPHISLS HYVEGHWKGE       840
     VKIVRNPVPK VRTGTVDMYG NYFEKGYLYP                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page