(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE163

PENCW_10.PE163       Location/Qualifiers
FT   CDS             join(complement(381731..381753),complement(381400..381527),
FT                   complement(381182..381284),complement(381011..381116))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948763"
FT                   /orf_name="Pc13g01630"
FT                   /product="Pc13g01630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91232.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI0001830773"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S3"
FT                   /transl_table=1
FT                   /translation="MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMV
FT                   ESAAIRDISEASVFAEYSVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRFN
FT                   KDGKKLQPPTAAKAL"
     MVKKRANNGR NKNGRGHVKP VRCSNCARCT PKDKAIKRFT IRNMVESAAI RDISEASVFA        60
     EYSVPKMYLK LQYCVSCAIH GKIVRVRSRE GRRNRAPPPR IRFNKDGKKL QPPTAAKAL        119
//

If you have problems or comments...

PBIL Back to PBIL home page