(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE166

PENCW_10.PE166       Location/Qualifiers
FT   CDS             join(complement(390005..390233),complement(389534..389906),
FT                   complement(389102..389456))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824608"
FT                   /orf_name="Pc13g01660"
FT                   /product="Pc13g01660 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91235.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830776"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S6"
FT                   /transl_table=1
FT                   /translation="MSLAKDILLFGATGTIGSFILDAILTERPQFGRVAIFTSPHTAEA
FT                   KASQLNKLKEQGVEVIVGNVEDENDVKAAYEGIDTVISALGRNALAQQIPLIRLAAASP
FT                   TVKWFLPSEYGTDIKYGPASANEKPHQLKLKVRAYLEDEISRDDLAYSYVVTGPFAEMY
FT                   LNLLPGMEEAGGWDVKGRRAVLLGEEGKGEVSLTTMTDVGTLVLNTLLHATAETRNAAL
FT                   CVNSFTTGPDQIQAEFERQLGGQPWDVSRTSLAKLREAEAAAWDAGNPAATVLTLRRIW
FT                   GEGGTLYSERANGLIGEPKMMGLEEVVANEIQRVSKL"
     MSLAKDILLF GATGTIGSFI LDAILTERPQ FGRVAIFTSP HTAEAKASQL NKLKEQGVEV        60
     IVGNVEDEND VKAAYEGIDT VISALGRNAL AQQIPLIRLA AASPTVKWFL PSEYGTDIKY       120
     GPASANEKPH QLKLKVRAYL EDEISRDDLA YSYVVTGPFA EMYLNLLPGM EEAGGWDVKG       180
     RRAVLLGEEG KGEVSLTTMT DVGTLVLNTL LHATAETRNA ALCVNSFTTG PDQIQAEFER       240
     QLGGQPWDVS RTSLAKLREA EAAAWDAGNP AATVLTLRRI WGEGGTLYSE RANGLIGEPK       300
     MMGLEEVVAN EIQRVSKL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page