(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE167

PENCW_10.PE167       Location/Qualifiers
FT   CDS             join(complement(391847..392731),complement(391606..391785),
FT                   complement(390574..391440))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948765"
FT                   /orf_name="Pc13g01670"
FT                   /product="Pc13g01670 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91236.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI0001830777"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7"
FT                   /transl_table=1
FT                   /translation="MAQLYWPSVVLILWSLFSLSTADTCWRETTCSGPTNTAFSGPWEK
FT                   NIYAPASRTVRPASTLSELKTNAVTDPAHPYKATLYGNGSIIVFDFGIEVGGIVHLDYT
FT                   STGSGALGLAFTEAKNWIGEWSDSSSALYHDGALYANISSTGKGTYVMPDKYLRGGFRY
FT                   LTVFLLTDYSTSVQIEDLTLELAFKPTWANLRAYQGYFHCSDELLNRIWYSGAYTLQTN
FT                   EVSVDTGRVTKGVTSGWVNNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDL
FT                   ESVKSALQIMYNTQNKTTGAFDESGPPLSQKGSDTYHMWSMIGTYKYVLYTNDTDFLFK
FT                   NWASYQHAMEYIYGKTGASLALWAGDSTNLSSIWSSQAANLKKAINTYCWDESYGAFKD
FT                   NATNTSLHPQDANSMAIMFGVVNEERTASISEKLLKNWTPIGAVAPELPENIASFISSF
FT                   EIQSHFIAHKPARALDLIRRSWGWYINNPNGTESTVIEGYLQNGTFGYRMDRGYGYDPS
FT                   YVSHAHGWSSGPTSALTEYVVGLSVVSPLGLTWKIAPQFGDLEFAEAGFVTSLGKFQAS
FT                   WILNSSGYVLTFSVPKGTDGNVTLPYVTASKKPSITIDGDQLMRGVAYADGAATVEVTG
FT                   GSHKVVVT"
     MAQLYWPSVV LILWSLFSLS TADTCWRETT CSGPTNTAFS GPWEKNIYAP ASRTVRPAST        60
     LSELKTNAVT DPAHPYKATL YGNGSIIVFD FGIEVGGIVH LDYTSTGSGA LGLAFTEAKN       120
     WIGEWSDSSS ALYHDGALYA NISSTGKGTY VMPDKYLRGG FRYLTVFLLT DYSTSVQIED       180
     LTLELAFKPT WANLRAYQGY FHCSDELLNR IWYSGAYTLQ TNEVSVDTGR VTKGVTSGWV       240
     NNGTLGPGDT IIVDGAKRDR AVWPGDMGIA VPSAFVSLGD LESVKSALQI MYNTQNKTTG       300
     AFDESGPPLS QKGSDTYHMW SMIGTYKYVL YTNDTDFLFK NWASYQHAME YIYGKTGASL       360
     ALWAGDSTNL SSIWSSQAAN LKKAINTYCW DESYGAFKDN ATNTSLHPQD ANSMAIMFGV       420
     VNEERTASIS EKLLKNWTPI GAVAPELPEN IASFISSFEI QSHFIAHKPA RALDLIRRSW       480
     GWYINNPNGT ESTVIEGYLQ NGTFGYRMDR GYGYDPSYVS HAHGWSSGPT SALTEYVVGL       540
     SVVSPLGLTW KIAPQFGDLE FAEAGFVTSL GKFQASWILN SSGYVLTFSV PKGTDGNVTL       600
     PYVTASKKPS ITIDGDQLMR GVAYADGAAT VEVTGGSHKV VVT                         643
//

If you have problems or comments...

PBIL Back to PBIL home page