(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE168

PENCW_10.PE168       Location/Qualifiers
FT   CDS             join(393481..393828,393954..394460,394537..394908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948766"
FT                   /orf_name="Pc13g01680"
FT                   /product="Pc13g01680 protein"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91237.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniParc:UPI0001830778"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S8"
FT                   /transl_table=1
FT                   /translation="MSGETVRPAFEGRERPLLSYGIAFPAATARHLDGTFRASRVYVIC
FT                   SGSLSRNTNVMDQLETALEPDRLVGHWIGMRSHTLWSEVLQIAEEVQTAHADLLLTVGA
FT                   GSLTDGAKIIALVLANRVSTPEELETLAEGPKKRKYIEAPTLPIISVPTSLSAGEYSNF
FT                   AGGTEDHSKRKYSFQPPIRGPELVILDPWLAKTSPGSIWLSTGVRAMDHCIESLCAIAG
FT                   TTTKSDKLALNALGLLVPGLLRCKRDRSDREAHLQCQLGSVDAMAACTSGSIELGASHG
FT                   IGHQLGPLGVGHGETSCILLPAVCKFNAKYNANREKQARVRQFLIQDPIVSDVLRARSV
FT                   NVETSDLGDILDAIIRELGMPRSLSDVQVGRDQLDGLAENSLHDRWCKTNPVPLKEKSQ
FT                   VLEILEMVV"
     MSGETVRPAF EGRERPLLSY GIAFPAATAR HLDGTFRASR VYVICSGSLS RNTNVMDQLE        60
     TALEPDRLVG HWIGMRSHTL WSEVLQIAEE VQTAHADLLL TVGAGSLTDG AKIIALVLAN       120
     RVSTPEELET LAEGPKKRKY IEAPTLPIIS VPTSLSAGEY SNFAGGTEDH SKRKYSFQPP       180
     IRGPELVILD PWLAKTSPGS IWLSTGVRAM DHCIESLCAI AGTTTKSDKL ALNALGLLVP       240
     GLLRCKRDRS DREAHLQCQL GSVDAMAACT SGSIELGASH GIGHQLGPLG VGHGETSCIL       300
     LPAVCKFNAK YNANREKQAR VRQFLIQDPI VSDVLRARSV NVETSDLGDI LDAIIRELGM       360
     PRSLSDVQVG RDQLDGLAEN SLHDRWCKTN PVPLKEKSQV LEILEMVV                    408
//

If you have problems or comments...

PBIL Back to PBIL home page