(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE169

PENCW_10.PE169       Location/Qualifiers
FT   CDS             395829..397076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949802"
FT                   /orf_name="Pc13g01690"
FT                   /product="Pc13g01690 protein"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAP91238.1"
FT                   /db_xref="GO:0016872"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI0001830779"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S9"
FT                   /transl_table=1
FT                   /translation="MASTLRQNPWWAYQSLTRQQLRTSRLSSRHLSTTPLRSNASNNPL
FT                   RSRASAAADLQHAAQAQRRMILSAAGIITCAAGLYGVIKLDLFGLNELDTNKDDKTTPP
FT                   KNGAMRMDGPVGFTNGGPSLITIKGQDRLEQVPTGTSTIPTFPSTIRLPTPEATEGKQT
FT                   GDDLAPSAGEEYQLLGLGIRTVSFLSIQVYVVGLYVAKSDITELQRRLLRTAIHPPTTD
FT                   DDAAISGAGATAATSLVSPERQQLRELLLDPEHGDAAWSAIIKDNGIRTAFRIVPTRNT
FT                   DFMHLRDGWVRGITARAQAKKTAEPGEFQDESFGSSMNDFKAVFGSGKGKSVPKGQTLV
FT                   LMRDAHGALDALFQPGADKPVKWMGRVADERISRLVWLNYLAGKNVSSEGARASIVDGL
FT                   MTIVERPLGTVVQKVI"
     MASTLRQNPW WAYQSLTRQQ LRTSRLSSRH LSTTPLRSNA SNNPLRSRAS AAADLQHAAQ        60
     AQRRMILSAA GIITCAAGLY GVIKLDLFGL NELDTNKDDK TTPPKNGAMR MDGPVGFTNG       120
     GPSLITIKGQ DRLEQVPTGT STIPTFPSTI RLPTPEATEG KQTGDDLAPS AGEEYQLLGL       180
     GIRTVSFLSI QVYVVGLYVA KSDITELQRR LLRTAIHPPT TDDDAAISGA GATAATSLVS       240
     PERQQLRELL LDPEHGDAAW SAIIKDNGIR TAFRIVPTRN TDFMHLRDGW VRGITARAQA       300
     KKTAEPGEFQ DESFGSSMND FKAVFGSGKG KSVPKGQTLV LMRDAHGALD ALFQPGADKP       360
     VKWMGRVADE RISRLVWLNY LAGKNVSSEG ARASIVDGLM TIVERPLGTV VQKVI            415
//

If you have problems or comments...

PBIL Back to PBIL home page