(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE17

PENCW_10.PE17        Location/Qualifiers
FT   CDS             join(complement(38276..38306),complement(37398..38068))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824329"
FT                   /orf_name="Pc13g00170"
FT                   /product="Pc13g00170 protein"
FT                   /protein_id="CAP91086.1"
FT                   /db_xref="UniParc:UPI0001830D03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G6"
FT                   /transl_table=1
FT                   /translation="MNAVKIGATTRGVSTFRESVPKKVPFRAQHLVLEAVQKMLEQSGF
FT                   RFVQRWLPQACRSAEWVCAESMELHRLFPLLNQNRKYASSKDFHQILAKLHSLRHTVSN
FT                   IRHAAVHRIVQDSESLLEMLQAAVAFASCIGDKECTQQLEFLCSTLNNLLFQMNERLHH
FT                   LQQRVLVQIRICHSRPAELMQRRALLPEAVRRLTEQSEDMFDLQVQGILRKNLLLCWYE
FT                   ASNQPSALQVS"
     MNAVKIGATT RGVSTFRESV PKKVPFRAQH LVLEAVQKML EQSGFRFVQR WLPQACRSAE        60
     WVCAESMELH RLFPLLNQNR KYASSKDFHQ ILAKLHSLRH TVSNIRHAAV HRIVQDSESL       120
     LEMLQAAVAF ASCIGDKECT QQLEFLCSTL NNLLFQMNER LHHLQQRVLV QIRICHSRPA       180
     ELMQRRALLP EAVRRLTEQS EDMFDLQVQG ILRKNLLLCW YEASNQPSAL QVS              233
//

If you have problems or comments...

PBIL Back to PBIL home page