(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE170

PENCW_10.PE170       Location/Qualifiers
FT   CDS             join(complement(397712..397862),complement(397430..397584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978061"
FT                   /orf_name="Pc13g01700"
FT                   /product="Pc13g01700 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91239.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183077A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T0"
FT                   /transl_table=1
FT                   /translation="MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTL
FT                   ELDLEEEGAAIQSALAEISSQRTVPNIFINKKHIGGNSDLQGKKDLKDLLKEAGAI"
     MSAAKTRAQS LINDNAVVVF SKSYCPYCDS SKKLLDSLNA KYTTLELDLE EEGAAIQSAL        60
     AEISSQRTVP NIFINKKHIG GNSDLQGKKD LKDLLKEAGA I                           101
//

If you have problems or comments...

PBIL Back to PBIL home page