(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE171

PENCW_10.PE171       Location/Qualifiers
FT   CDS             join(397909..397920,397979..398050,398152..398205,
FT                   398355..398497,398559..398691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129221"
FT                   /orf_name="Pc13g01710"
FT                   /product="Putative uncharacterized protein Pc13g01710 "
FT                   /protein_id="CAP91240.1"
FT                   /db_xref="UniParc:UPI000183077B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T1"
FT                   /transl_table=1
FT                   /translation="MDEMGGVRDDERIGGRFRQISGIERCDDLVAAKYILIYLTRRLVG
FT                   EADQTKERGEIASKKAWEYGKTGFKDVSERNPKIGEKKRNHRVKKVTGRFESLIPILSI
FT                   AIWSELFRIPSYHFGRKNNGHRRREEKYQGMDA"
     MDEMGGVRDD ERIGGRFRQI SGIERCDDLV AAKYILIYLT RRLVGEADQT KERGEIASKK        60
     AWEYGKTGFK DVSERNPKIG EKKRNHRVKK VTGRFESLIP ILSIAIWSEL FRIPSYHFGR       120
     KNNGHRRREE KYQGMDA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page