(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE172

PENCW_10.PE172       Location/Qualifiers
FT   CDS             join(complement(400538..400568),complement(398967..400465))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824869"
FT                   /orf_name="Pc13g01720"
FT                   /product="Pc13g01720 protein"
FT                   /protein_id="CAP91241.1"
FT                   /db_xref="UniParc:UPI000183077C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T2"
FT                   /transl_table=1
FT                   /translation="MGFCGATCEREKKALISFSPQENHSSKQRNSHDSNSVRPKFSRQR
FT                   TSNGSRSSSVSRTARTHESPYLASNRGRREPSLNRHGSEAGSMRDAFGHEAASRKETEE
FT                   ANDGESYLDGKTNQEKWIHRDKLAKIESEELHQAAILFQRRMRGESKSSSGRGRSHDAH
FT                   PANGTGTATSPATEYSEPWPKVKEESGKQDVNDNVEDDEREHWDLRRPEEIAADDAAAS
FT                   IYSHPSLGKSASRIPVSTASPVPISAALGRDSRSSRSRAATDEEDRSSRSRRASEPINI
FT                   EQDGSTPSPESRPGSRGFSSTPNTLGKKTVKPTTGSTNRKTSAPPTNRKASTPRSRAVS
FT                   GNNIQRPTTRGGEPRPSTAVNRPEGDPPWLATMYKPDPRLPPDQQMIPTVAKRIMQEQW
FT                   EKEGRTPNTYDRNFEPLAVHPPDAPPAATKAEPEQQPVESLQLEELPPQPPKSPEPPRP
FT                   NTSTGYSTMPKVQDTPPMGLTPNPNPNWSPPVVTAQQAPKKEKSCGCCVVM"
     MGFCGATCER EKKALISFSP QENHSSKQRN SHDSNSVRPK FSRQRTSNGS RSSSVSRTAR        60
     THESPYLASN RGRREPSLNR HGSEAGSMRD AFGHEAASRK ETEEANDGES YLDGKTNQEK       120
     WIHRDKLAKI ESEELHQAAI LFQRRMRGES KSSSGRGRSH DAHPANGTGT ATSPATEYSE       180
     PWPKVKEESG KQDVNDNVED DEREHWDLRR PEEIAADDAA ASIYSHPSLG KSASRIPVST       240
     ASPVPISAAL GRDSRSSRSR AATDEEDRSS RSRRASEPIN IEQDGSTPSP ESRPGSRGFS       300
     STPNTLGKKT VKPTTGSTNR KTSAPPTNRK ASTPRSRAVS GNNIQRPTTR GGEPRPSTAV       360
     NRPEGDPPWL ATMYKPDPRL PPDQQMIPTV AKRIMQEQWE KEGRTPNTYD RNFEPLAVHP       420
     PDAPPAATKA EPEQQPVESL QLEELPPQPP KSPEPPRPNT STGYSTMPKV QDTPPMGLTP       480
     NPNPNWSPPV VTAQQAPKKE KSCGCCVVM                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page