(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE173

PENCW_10.PE173       Location/Qualifiers
FT   CDS             complement(401778..402719)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129222"
FT                   /orf_name="Pc13g01730"
FT                   /product="Pc13g01730 protein"
FT                   /biological_process="apoptosis"
FT                   /protein_id="CAP91242.1"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0001830839"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T3"
FT                   /transl_table=1
FT                   /translation="MSWRNPLKMLRRSPSYAPASNPQVSDGDFSYIAPSDIADPAADDA
FT                   EPDIIALRHRGTIYPLRFRAYSIDDNVLTIGDLRQAAAESTGAGHPDCVRLLYKGKLLK
FT                   NNAQTCKAEGLKQHSEVLCVVSEAGAGSPSDGSDDGHKIPVTTSAPTPPPLPRPTSAGD
FT                   ASSPPTPPSGKSKSSRRKKRNGKKSPVSSEAPGPSRPPRPTSSGHSAASAQPPNLKLLN
FT                   TPLEKIAALTGWFEQVMKPQCEEYTANPPSDPKKRGDEHRKLSETVLQSVQLVADGIEP
FT                   NGDETVRSARRALIRDSQAVLTELDRVLHSVA"
     MSWRNPLKML RRSPSYAPAS NPQVSDGDFS YIAPSDIADP AADDAEPDII ALRHRGTIYP        60
     LRFRAYSIDD NVLTIGDLRQ AAAESTGAGH PDCVRLLYKG KLLKNNAQTC KAEGLKQHSE       120
     VLCVVSEAGA GSPSDGSDDG HKIPVTTSAP TPPPLPRPTS AGDASSPPTP PSGKSKSSRR       180
     KKRNGKKSPV SSEAPGPSRP PRPTSSGHSA ASAQPPNLKL LNTPLEKIAA LTGWFEQVMK       240
     PQCEEYTANP PSDPKKRGDE HRKLSETVLQ SVQLVADGIE PNGDETVRSA RRALIRDSQA       300
     VLTELDRVLH SVA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page