(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE174

PENCW_10.PE174       Location/Qualifiers
FT   CDS             join(404979..405030,405216..405356,405459..405589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949803"
FT                   /orf_name="Pc13g01740"
FT                   /product="Putative uncharacterized protein Pc13g01740 "
FT                   /protein_id="CAP91243.1"
FT                   /db_xref="UniParc:UPI000183083A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T4"
FT                   /transl_table=1
FT                   /translation="MEDDKPLAVTAIHVATPLWVTCTRRLCRLRHIACTQHFVVIANIY
FT                   APPALILLSGWMQLPVICQAYGCLVVGHATTDEKYRSDRNVIQPRYGPGAFCGVQTPCL
FT                   AVS"
     MEDDKPLAVT AIHVATPLWV TCTRRLCRLR HIACTQHFVV IANIYAPPAL ILLSGWMQLP        60
     VICQAYGCLV VGHATTDEKY RSDRNVIQPR YGPGAFCGVQ TPCLAVS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page