(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE175

PENCW_10.PE175       Location/Qualifiers
FT   CDS             join(complement(409596..409903),complement(407803..409537))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978062"
FT                   /orf_name="Pc13g01750"
FT                   /product="Pc13g01750 protein"
FT                   /protein_id="CAP91244.1"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniParc:UPI000183083B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5"
FT                   /transl_table=1
FT                   /translation="MFPVSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYL
FT                   SVPIFLALALPASVVLLVPIDLASSSRDGSGPKAIWLPERMVLVCWRIAYWLIFVLTWV
FT                   ILPLLGEYVDSGYREPKGRLMYSLRSNAKYQLIVLGCALVGLVYVSISNGFEFRSIKGL
FT                   IMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPRVHDRLMDSVNEL
FT                   ANLNSQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRIPILESPDTSATIPSVITERY
FT                   LADLTRRLQRARHMKARFVDEWDRLVQLSADLQAIINSTASKKLEFAPAARRSSCIPRV
FT                   KFLNPYMRYQLYSNVIPSVRLAFGAFFAVASVCIVWSEMIKSLAPHLSAISLTVVPNWK
FT                   DSPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWYAGLVARLT
FT                   VPIAYNFLTFLPKDFRRSTTFYEFLGKLINLTPLGKGFDFIFPIFILLPICATLFNLYG
FT                   RIKNIFGCGLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGSRSTW
FT                   ASDRDDEGSPGSSRLRVPVAEGSQPAQRSVVAPTIVGGEEDDDENFFQSFAHRVKNTFD
FT                   TTNTPRWFQGEPFRLPRWMSGDNNTTEEGSALFGGRAVPGRLRLG"
     MFPVSVSPIS VGSNVFFAFA LFLISALVLL LLRRFLTLRA TPAYLSVPIF LALALPASVV        60
     LLVPIDLASS SRDGSGPKAI WLPERMVLVC WRIAYWLIFV LTWVILPLLG EYVDSGYREP       120
     KGRLMYSLRS NAKYQLIVLG CALVGLVYVS ISNGFEFRSI KGLIMALAYV WGLVLAIYLM       180
     GHGLVSIPRN LLRNSNVSGR LRRLQAHAPR VHDRLMDSVN ELANLNSQVS QLQRRKTGTA       240
     RDFQEWIEEL REGHGQSDVR IPILESPDTS ATIPSVITER YLADLTRRLQ RARHMKARFV       300
     DEWDRLVQLS ADLQAIINST ASKKLEFAPA ARRSSCIPRV KFLNPYMRYQ LYSNVIPSVR       360
     LAFGAFFAVA SVCIVWSEMI KSLAPHLSAI SLTVVPNWKD SPVGFGGQLT ASAWLLYMCS       420
     AALVGVSDVK VWGNRALVRR NTYGESACWY AGLVARLTVP IAYNFLTFLP KDFRRSTTFY       480
     EFLGKLINLT PLGKGFDFIF PIFILLPICA TLFNLYGRIK NIFGCGLAED DDIHDVENNP       540
     AGYGMGGWRE GRDLIERELN GFGSLAVSSR GSRSTWASDR DDEGSPGSSR LRVPVAEGSQ       600
     PAQRSVVAPT IVGGEEDDDE NFFQSFAHRV KNTFDTTNTP RWFQGEPFRL PRWMSGDNNT       660
     TEEGSALFGG RAVPGRLRLG                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page