(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE176

PENCW_10.PE176       Location/Qualifiers
FT   CDS             join(complement(411465..411494),complement(411300..411386),
FT                   complement(410897..411250),complement(410604..410666),
FT                   complement(410154..410276))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129223"
FT                   /orf_name="Pc13g01760"
FT                   /product="Putative uncharacterized protein Pc13g01760 "
FT                   /protein_id="CAP91245.1"
FT                   /db_xref="UniParc:UPI000183083C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T7"
FT                   /transl_table=1
FT                   /translation="MGDQWAIRAEEVQHGLISGREKKGKQVLVWNRDSSRSGRGTNTNT
FT                   DQHNEESKAFGQQRQMNSIRWPPPDCGLERMKTVVGWIGSVTGIMQPSSRTGPQLLSSL
FT                   HNGETIGGLKDKEHRYLRKIRMTLRQRQMSAQISLSWGAQSKKKWRSSEGYYDGGHKAS
FT                   SEVLPVLPGFPLLGQFSSRSTRRSGPDLIRRNQLVKMPETLPGGCGRVPGTPLYT"
     MGDQWAIRAE EVQHGLISGR EKKGKQVLVW NRDSSRSGRG TNTNTDQHNE ESKAFGQQRQ        60
     MNSIRWPPPD CGLERMKTVV GWIGSVTGIM QPSSRTGPQL LSSLHNGETI GGLKDKEHRY       120
     LRKIRMTLRQ RQMSAQISLS WGAQSKKKWR SSEGYYDGGH KASSEVLPVL PGFPLLGQFS       180
     SRSTRRSGPD LIRRNQLVKM PETLPGGCGR VPGTPLYT                               218
//

If you have problems or comments...

PBIL Back to PBIL home page