(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE178

PENCW_10.PE178       Location/Qualifiers
FT   CDS             join(416680..416763,416821..416897,416972..417856,
FT                   417912..418185)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949805"
FT                   /orf_name="Pc13g01780"
FT                   /product="Pc13g01780 protein"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91247.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="InterPro:IPR012404"
FT                   /db_xref="UniParc:UPI000183083E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T9"
FT                   /transl_table=1
FT                   /translation="MANNALIPLLVTMMLVTGVCNTILNKYQDMQCVRNCDSPDPNQRK
FT                   LFEQPVIQTAVMFIGEMGCWLVVGLNFVYRQYIAPRLSSDPSPLLTGGYHPINGYDEGI
FT                   DNEDDHTVDGLDSDSRHPKPLPEIDSRIPLRGLKVLLLAAPSSCDIAGTTLMNVGLLFV
FT                   AASIYQMTRGALVLFVGLFSVLFLRRRLHLYQWSALFIVVLGVAIVGLSGALFSGDSGH
FT                   DINQNASVTDVASRALIQARDVARTPEAVQTIIGVLLIAAAQIFTATQFVLEEWILEHY
FT                   AMEPIHVVGWEGVFGFLVTVVGMLIMYLIVGRTDAGRYGYFDVKQGLHELLANRAVAIS
FT                   SVFIMISIGGFNFFGLSVTRTVSATSRSTIDTCRTLFIWIVSLGLGWETFKWLQVVGFA
FT                   LLVYGTFMFNDIVRPPIKACLPRDRREGEVLLPEGPIEHI"
     MANNALIPLL VTMMLVTGVC NTILNKYQDM QCVRNCDSPD PNQRKLFEQP VIQTAVMFIG        60
     EMGCWLVVGL NFVYRQYIAP RLSSDPSPLL TGGYHPINGY DEGIDNEDDH TVDGLDSDSR       120
     HPKPLPEIDS RIPLRGLKVL LLAAPSSCDI AGTTLMNVGL LFVAASIYQM TRGALVLFVG       180
     LFSVLFLRRR LHLYQWSALF IVVLGVAIVG LSGALFSGDS GHDINQNASV TDVASRALIQ       240
     ARDVARTPEA VQTIIGVLLI AAAQIFTATQ FVLEEWILEH YAMEPIHVVG WEGVFGFLVT       300
     VVGMLIMYLI VGRTDAGRYG YFDVKQGLHE LLANRAVAIS SVFIMISIGG FNFFGLSVTR       360
     TVSATSRSTI DTCRTLFIWI VSLGLGWETF KWLQVVGFAL LVYGTFMFND IVRPPIKACL       420
     PRDRREGEVL LPEGPIEHI                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page