(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE179

PENCW_10.PE179       Location/Qualifiers
FT   CDS             join(complement(421451..421596),complement(421206..421394),
FT                   complement(419021..421154),complement(418852..418947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949806"
FT                   /orf_name="Pc13g01790"
FT                   /product="Pc13g01790 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAP91248.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI000183083F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U0"
FT                   /transl_table=1
FT                   /translation="MQSNISTVKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCTLGNIASVEMSRDLFPEVESLMSTANPYIRRKAAIC
FT                   AMRICRKVPDLYEHFLEKAKNLLSDRNHGVLLCGLTLAIDLCEAEEEEEEEEEGGPVGV
FT                   IEMFRPLAGGLVRALKGLTTSGYAPEHDVSGITDPFLQVKILRFLRVLGRGDVATSELI
FT                   NDILAQVATNTDSSKNVGNSILYEAVLTILDIEADSGLRVLGVNILGKFLANKDNNIRY
FT                   VALNTLNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINEDNVRVLVREL
FT                   LAFLEVADNEFKSVMTTQIGIAADRFAPNKRWHMDTILRVLKLAGNYVKEQILSSFVRL
FT                   IATTPDLQTYAVQKLYSSLKEDISQEGLTLAATWTIGEYADSLLQGGQYEEEELVKEVR
FT                   ESDIVDLFTNILNSTYASQIAVEYIITASMKLTVRMSDPAQIERLRRLLSSRTADLSVE
FT                   IQQRAVEYTNLFGYDQIRRGVLERMPPPEIREEQRVLGAAPAAKKRQSKLLRGKSTTKV
FT                   AKPAEHDLLLDLVGGSDAPVTSPTSGGSNTADLLADILGGDSGMSSPSPGPAGQKNAIM
FT                   DLFGSNGPSPSPQPTQPTSASMDLLGAGGMGVSAPSPTTSPAPVTASTPAHTALNKDGL
FT                   VLTLQVQRSGNIAQILARFRNDSNFDRFTSVGLQAAVPKSQRLQLSAITKADLEAGDEG
FT                   TQSLRVTALNGGLPAKLRLRLRVTCARDGGNPVTDQVDWSEP"
     MQSNISTVKQ FIRNVRSAKT IADERAVIQK ESAAIRASFR EESHDSGIRR NNVAKLLYLF        60
     TLGERTHFGQ IECLKLLASH RFADKRLGYL GTMLLLDENQ EVLTLVTNSL KNDLNHSNQY       120
     IVGLALCTLG NIASVEMSRD LFPEVESLMS TANPYIRRKA AICAMRICRK VPDLYEHFLE       180
     KAKNLLSDRN HGVLLCGLTL AIDLCEAEEE EEEEEEGGPV GVIEMFRPLA GGLVRALKGL       240
     TTSGYAPEHD VSGITDPFLQ VKILRFLRVL GRGDVATSEL INDILAQVAT NTDSSKNVGN       300
     SILYEAVLTI LDIEADSGLR VLGVNILGKF LANKDNNIRY VALNTLNKVV AIEPNAVQRH       360
     RNTILECLRD PDISIRRRAL DLSFMLINED NVRVLVRELL AFLEVADNEF KSVMTTQIGI       420
     AADRFAPNKR WHMDTILRVL KLAGNYVKEQ ILSSFVRLIA TTPDLQTYAV QKLYSSLKED       480
     ISQEGLTLAA TWTIGEYADS LLQGGQYEEE ELVKEVRESD IVDLFTNILN STYASQIAVE       540
     YIITASMKLT VRMSDPAQIE RLRRLLSSRT ADLSVEIQQR AVEYTNLFGY DQIRRGVLER       600
     MPPPEIREEQ RVLGAAPAAK KRQSKLLRGK STTKVAKPAE HDLLLDLVGG SDAPVTSPTS       660
     GGSNTADLLA DILGGDSGMS SPSPGPAGQK NAIMDLFGSN GPSPSPQPTQ PTSASMDLLG       720
     AGGMGVSAPS PTTSPAPVTA STPAHTALNK DGLVLTLQVQ RSGNIAQILA RFRNDSNFDR       780
     FTSVGLQAAV PKSQRLQLSA ITKADLEAGD EGTQSLRVTA LNGGLPAKLR LRLRVTCARD       840
     GGNPVTDQVD WSEP                                                         854
//

If you have problems or comments...

PBIL Back to PBIL home page