(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE18

PENCW_10.PE18        Location/Qualifiers
FT   CDS             join(38747..39148,39205..40218,40283..40510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671649"
FT                   /orf_name="Pc13g00180"
FT                   /product="Pc13g00180 protein"
FT                   /protein_id="CAP91087.1"
FT                   /db_xref="UniParc:UPI0001830D04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7"
FT                   /transl_table=1
FT                   /translation="MASGLEVVGLALAVFPILVEGLKFYADKKGRVRDFIHYRHLLKRI
FT                   VRDLSREQISFQNSSQLFLENISMHYGLSSNDIQEMMQNPQDARWRKGIPFQSDYLIEK
FT                   SVAIYLETVEDMNEVLIKIQDTVGTREGAHPALLDKSTFRRQWRKITLVLGEEDIKKHL
FT                   ERARGLNTFLSQLTEQNKPTSLADSVLQRSTLHYERIRRHAIELFEIFQANLSTSVICK
FT                   CVLGHTVNMKLEFRSARITAKRLFFRTLFTFDRAEPNLTPPYNWREVEIEPLLSARLCH
FT                   ETISHKAVNLFADSSTVQTADSTSSELPNICTVIKGPIQSGWLGYLANSQGCRHRIRVL
FT                   ALDQISAALETIQTISLAAVLDHREFRLVHRYRLGLKLASSVMQLHTTQWLPDYWNKSD
FT                   ISFPCFSDGKIDFNNPLIKRGFGSEEKQNSMAFTSGLSNCGSVPCLFSLGVVLLELIER
FT                   QSIETMKNNSYDDSNTGQVTVELTKRLANSTDCSPNYKKVMKRCIGGLDAAFESLEDGD
FT                   FRDEVEQKIILPLEEDLKFYCDKGYIEDCV"
     MASGLEVVGL ALAVFPILVE GLKFYADKKG RVRDFIHYRH LLKRIVRDLS REQISFQNSS        60
     QLFLENISMH YGLSSNDIQE MMQNPQDARW RKGIPFQSDY LIEKSVAIYL ETVEDMNEVL       120
     IKIQDTVGTR EGAHPALLDK STFRRQWRKI TLVLGEEDIK KHLERARGLN TFLSQLTEQN       180
     KPTSLADSVL QRSTLHYERI RRHAIELFEI FQANLSTSVI CKCVLGHTVN MKLEFRSARI       240
     TAKRLFFRTL FTFDRAEPNL TPPYNWREVE IEPLLSARLC HETISHKAVN LFADSSTVQT       300
     ADSTSSELPN ICTVIKGPIQ SGWLGYLANS QGCRHRIRVL ALDQISAALE TIQTISLAAV       360
     LDHREFRLVH RYRLGLKLAS SVMQLHTTQW LPDYWNKSDI SFPCFSDGKI DFNNPLIKRG       420
     FGSEEKQNSM AFTSGLSNCG SVPCLFSLGV VLLELIERQS IETMKNNSYD DSNTGQVTVE       480
     LTKRLANSTD CSPNYKKVMK RCIGGLDAAF ESLEDGDFRD EVEQKIILPL EEDLKFYCDK       540
     GYIEDCV                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page