(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE182

PENCW_10.PE182       Location/Qualifiers
FT   CDS             425534..426013
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949808"
FT                   /orf_name="Pc13g01820"
FT                   /product="Putative uncharacterized protein Pc13g01820 "
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91251.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="UniParc:UPI0001830841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U2"
FT                   /transl_table=1
FT                   /translation="MGQFEHFFPIENLTEAGKGYFNYALCQSDRMRPYQLDNPIEEGLR
FT                   GVYLSDDVTVNLLANASGIFATLEYSWIPSYNNYTLQWFYQDLLEEIFLIFGEKYNVRP
FT                   HWNKMLFNDGTYASNIYPKINSWLDIQEQMDPHCQFVNEFLAESLGIERCVSLFQ"
     MGQFEHFFPI ENLTEAGKGY FNYALCQSDR MRPYQLDNPI EEGLRGVYLS DDVTVNLLAN        60
     ASGIFATLEY SWIPSYNNYT LQWFYQDLLE EIFLIFGEKY NVRPHWNKML FNDGTYASNI       120
     YPKINSWLDI QEQMDPHCQF VNEFLAESLG IERCVSLFQ                              159
//

If you have problems or comments...

PBIL Back to PBIL home page