(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE183

PENCW_10.PE183       Location/Qualifiers
FT   CDS             join(complement(428571..428845),complement(427238..428495))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978063"
FT                   /orf_name="Pc13g01830"
FT                   /product="Pc13g01830 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91252.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830842"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U3"
FT                   /transl_table=1
FT                   /translation="MSTPPDIDPYAVLGVAKEATIPEIRAAHRKRVLKCHPDKIQDESQ
FT                   RIAAQDEFQKVQQAYELLSDDVRRTKHDQKVKIAELKRELLERRRTEVPMEVFFEEAMR
FT                   FTDEPRTMSRKFEDFGVRSKSKPTEEKKKARAPTSTYHQAKEKRETAKATHSDRAKTRD
FT                   QERRRQRQAEAKYDSTFDVCAESDDASDSSVPRYAHKRTSTPRRERERDSRSRPSESSR
FT                   RRERRYDEDDDISDHWQSKIESQYFNAEDYIASKTRKSKSPRRYHGHDSAEPESSTSRS
FT                   AGRSTRTRRRSSSRDRSYEHLESPRAYEVKPPKMQPSATSPGIKVPLRPSFLNTRAATS
FT                   SGFRQKRESRDSTLYEMAHEPLPSRTSKMRDRNDSGYSSPGTPEMLPRGTSPKTLYTVV
FT                   QEADHVVVEPKSSKYRSARSPDRDRVPSTRQVPKRSSTFQAYTEAAPRVETRSARPSSR
FT                   THPVEYITTAPKGNVKYGRTYKPEDVSYSPRRDYYYDEEYRPPAVGRRQSAY"
     MSTPPDIDPY AVLGVAKEAT IPEIRAAHRK RVLKCHPDKI QDESQRIAAQ DEFQKVQQAY        60
     ELLSDDVRRT KHDQKVKIAE LKRELLERRR TEVPMEVFFE EAMRFTDEPR TMSRKFEDFG       120
     VRSKSKPTEE KKKARAPTST YHQAKEKRET AKATHSDRAK TRDQERRRQR QAEAKYDSTF       180
     DVCAESDDAS DSSVPRYAHK RTSTPRRERE RDSRSRPSES SRRRERRYDE DDDISDHWQS       240
     KIESQYFNAE DYIASKTRKS KSPRRYHGHD SAEPESSTSR SAGRSTRTRR RSSSRDRSYE       300
     HLESPRAYEV KPPKMQPSAT SPGIKVPLRP SFLNTRAATS SGFRQKRESR DSTLYEMAHE       360
     PLPSRTSKMR DRNDSGYSSP GTPEMLPRGT SPKTLYTVVQ EADHVVVEPK SSKYRSARSP       420
     DRDRVPSTRQ VPKRSSTFQA YTEAAPRVET RSARPSSRTH PVEYITTAPK GNVKYGRTYK       480
     PEDVSYSPRR DYYYDEEYRP PAVGRRQSAY                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page