(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE184

PENCW_10.PE184       Location/Qualifiers
FT   CDS             join(430311..430393,430474..430549,430684..430770,
FT                   430841..430921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129224"
FT                   /orf_name="Pc13g01840"
FT                   /product="Putative uncharacterized protein Pc13g01840 "
FT                   /protein_id="CAP91253.1"
FT                   /db_xref="UniParc:UPI0001830843"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U4"
FT                   /transl_table=1
FT                   /translation="MLNGAACASPDHDESIGKSANAERVNAVLPVILLFCVKVSYVLAQ
FT                   EWPTIHSNAIIALDHSHSFQPDCASRIHNPPIPSVVLLPLFPDSHANPARTGLGWIHNW
FT                   TLAA"
     MLNGAACASP DHDESIGKSA NAERVNAVLP VILLFCVKVS YVLAQEWPTI HSNAIIALDH        60
     SHSFQPDCAS RIHNPPIPSV VLLPLFPDSH ANPARTGLGW IHNWTLAA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page