(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE186

PENCW_10.PE186       Location/Qualifiers
FT   CDS             join(complement(433317..433512),complement(432227..433170))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949810"
FT                   /orf_name="Pc13g01860"
FT                   /product="Pc13g01860 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91255.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001830845"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A6"
FT                   /transl_table=1
FT                   /translation="MRQKTRFVCVSDTHGYTPSETGFKLPAGDVLIHAGDLTNNGSLKE
FT                   LCRTMDWICKADFEIKIIVGGNHDVTLDQAFYREHGARFHGQHLEDSYHCLNLIMESPS
FT                   VVLLRHEPALIRLTRADGPNTVFKIFGSPYSQSPGNWAFGYESNDAAALWAQIPIDTDI
FT                   VVTHTPPQSHCDQKPNGMFVGCAALRSALSLIRPHLAVCGHVHEGRGYERVRWRGNLIN
FT                   TEIETETGPESDSVDHVTRGVLPPMGSKKQSLVDLTGKRDKRLDNEGFSHPRPRQHDLT
FT                   ETQPISSASPGSESSAGVPEKASQRNSPSTHPSLGAGSPGPNSRGFDYALQTLRKETCI
FT                   VNAAIMSTSWPHQGGKRFNSPIVVDLELPVWQNHAVANG"
     MRQKTRFVCV SDTHGYTPSE TGFKLPAGDV LIHAGDLTNN GSLKELCRTM DWICKADFEI        60
     KIIVGGNHDV TLDQAFYREH GARFHGQHLE DSYHCLNLIM ESPSVVLLRH EPALIRLTRA       120
     DGPNTVFKIF GSPYSQSPGN WAFGYESNDA AALWAQIPID TDIVVTHTPP QSHCDQKPNG       180
     MFVGCAALRS ALSLIRPHLA VCGHVHEGRG YERVRWRGNL INTEIETETG PESDSVDHVT       240
     RGVLPPMGSK KQSLVDLTGK RDKRLDNEGF SHPRPRQHDL TETQPISSAS PGSESSAGVP       300
     EKASQRNSPS THPSLGAGSP GPNSRGFDYA LQTLRKETCI VNAAIMSTSW PHQGGKRFNS       360
     PIVVDLELPV WQNHAVANG                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page