(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE187

PENCW_10.PE187       Location/Qualifiers
FT   CDS             join(434279..434299,434391..434526,434732..435044,
FT                   435116..435254)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949811"
FT                   /orf_name="Pc13g01870"
FT                   /product="Pc13g01870 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP91256.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="UniParc:UPI0001830846"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A7"
FT                   /transl_table=1
FT                   /translation="MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNIS
FT                   GEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMIPHKTARGAAAMERL
FT                   KVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRK
FT                   VKSKAYYERKKAARRVLAKAEQGANVDSKTKTQLAQYGY"
     MSSFESVVVI DGKGHLLGRL ASTVAKQLLN GQKIVVVRCE ALNISGEFFR AKLKYHAYLR        60
     KMTRFNPTRG GPFHFRAPSR ILYKAIRGMI PHKTARGAAA MERLKVFEGV PPPYDKKKRV       120
     VVPQALRVLR LRPGRKYCTV GRLSHEVGWK YQDVVSRLEE RRKVKSKAYY ERKKAARRVL       180
     AKAEQGANVD SKTKTQLAQY GY                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page