(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE188

PENCW_10.PE188       Location/Qualifiers
FT   CDS             complement(435946..437340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949812"
FT                   /orf_name="Pc13g01880"
FT                   /product="Pc13g01880 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91257.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniParc:UPI0001830847"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A8"
FT                   /transl_table=1
FT                   /translation="MLIHLLQSLRISQNGPLVIRGAIVLILPLCILLAVVIQSGNIHTT
FT                   RRRLRHLQKLGLTTSNMADQYNPKFCLPPGTAIDGAPRIKAIYLHPIKSCGPVEVDRAL
FT                   LTKSGFMYDRCFAFATKSVTGDDTAASKWKFISQRKNPVMSRVKTELWLPHKYSNLRDP
FT                   LVQSGGCVVMTFEDPDLPSWTSRVETFFHTRNLSAPSQLSFIVPLDVTAAQAKLKTFGI
FT                   HSRDAKGLDIGGIPSIAAALPKLKKFLGIPADQMLTLFKCTPDTLTRTDKNLAPLEHIG
FT                   SPALHGYTDQQPVNINSLSSVHAVSALLPTENQPLNALRFRANIWIINAPAYEEETWKR
FT                   YRILPKSNGTQPRASVAPALSVVCRTSRCTMPNVNPETGSFDADTPPPGRKRGKAQPST
FT                   TLVQYRTVETGNKAALGYLGMHCVPEDGSLKSAEEQGAGLYIEVGDEIEVLERGAHLYG
FT                   STGDDY"
     MLIHLLQSLR ISQNGPLVIR GAIVLILPLC ILLAVVIQSG NIHTTRRRLR HLQKLGLTTS        60
     NMADQYNPKF CLPPGTAIDG APRIKAIYLH PIKSCGPVEV DRALLTKSGF MYDRCFAFAT       120
     KSVTGDDTAA SKWKFISQRK NPVMSRVKTE LWLPHKYSNL RDPLVQSGGC VVMTFEDPDL       180
     PSWTSRVETF FHTRNLSAPS QLSFIVPLDV TAAQAKLKTF GIHSRDAKGL DIGGIPSIAA       240
     ALPKLKKFLG IPADQMLTLF KCTPDTLTRT DKNLAPLEHI GSPALHGYTD QQPVNINSLS       300
     SVHAVSALLP TENQPLNALR FRANIWIINA PAYEEETWKR YRILPKSNGT QPRASVAPAL       360
     SVVCRTSRCT MPNVNPETGS FDADTPPPGR KRGKAQPSTT LVQYRTVETG NKAALGYLGM       420
     HCVPEDGSLK SAEEQGAGLY IEVGDEIEVL ERGAHLYGST GDDY                        464
//

If you have problems or comments...

PBIL Back to PBIL home page