(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE189

PENCW_10.PE189       Location/Qualifiers
FT   CDS             join(438241..438378,438440..438635,438688..439134,
FT                   439203..439832,439888..440195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824870"
FT                   /orf_name="Pc13g01890"
FT                   /product="Pc13g01890 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91258.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI0001830904"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A9"
FT                   /transl_table=1
FT                   /translation="MSGSKSRLSGLLGHFTGSTPPVEHRVNTHTLSPTFFLPRAAAVEP
FT                   NAEAIYHVTANNKILRRSYGETADRARGMAYYLKKHGLSRVGILCPNTPAFLESIFGIA
FT                   AAGAVNIAVNYRLKQEDIAYIFDHGDAEVIIVDEEYVPLLEHYRSQHPRIPIIVDTDTD
FT                   ATEGELTGPFDEAVLEGLRHDIDTGSRGWEGLESQAADEESTIALAYTSGTTARPKGVE
FT                   FSHRGCYLATLGNVIETGLNYHRGRARYLWTLPMFHAMGWTFPWAVTAVRGTHYCLRKI
FT                   DYPEIWRLLKEEHITHFNAAPTVNTLLCNAKEAERLPEPVRVTVAASPPTPLLFEQMTD
FT                   LNLHPVHVYGMTETYGPITKGYHLPEWDELPLKDKYQRMARQGHGFITSLPARVIKTEV
FT                   PAGTITDVRKDGQEIGEIVFVGNICARGYYKDPEATRKLFAGGVLHSGDLAVWHPDGAI
FT                   QILDRAKDIIISGGENISSVALESMLVMHPDILEAGVVAVPDSHWGERPKAFVTVKEGK
FT                   SLQGSDLIDWARNTSGISKFMIPREVEVVTELPKTSTGKIRKNILRDWVKGPREA"
     MSGSKSRLSG LLGHFTGSTP PVEHRVNTHT LSPTFFLPRA AAVEPNAEAI YHVTANNKIL        60
     RRSYGETADR ARGMAYYLKK HGLSRVGILC PNTPAFLESI FGIAAAGAVN IAVNYRLKQE       120
     DIAYIFDHGD AEVIIVDEEY VPLLEHYRSQ HPRIPIIVDT DTDATEGELT GPFDEAVLEG       180
     LRHDIDTGSR GWEGLESQAA DEESTIALAY TSGTTARPKG VEFSHRGCYL ATLGNVIETG       240
     LNYHRGRARY LWTLPMFHAM GWTFPWAVTA VRGTHYCLRK IDYPEIWRLL KEEHITHFNA       300
     APTVNTLLCN AKEAERLPEP VRVTVAASPP TPLLFEQMTD LNLHPVHVYG MTETYGPITK       360
     GYHLPEWDEL PLKDKYQRMA RQGHGFITSL PARVIKTEVP AGTITDVRKD GQEIGEIVFV       420
     GNICARGYYK DPEATRKLFA GGVLHSGDLA VWHPDGAIQI LDRAKDIIIS GGENISSVAL       480
     ESMLVMHPDI LEAGVVAVPD SHWGERPKAF VTVKEGKSLQ GSDLIDWARN TSGISKFMIP       540
     REVEVVTELP KTSTGKIRKN ILRDWVKGPR EA                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page