(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE19

PENCW_10.PE19        Location/Qualifiers
FT   CDS             join(complement(43648..44000),complement(43361..43586),
FT                   complement(43242..43301),complement(42899..43189),
FT                   complement(42617..42845),complement(42151..42560))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128678"
FT                   /orf_name="Pc13g00190"
FT                   /product="Pc13g00190 protein"
FT                   /protein_id="CAP91088.1"
FT                   /db_xref="UniParc:UPI0001830D05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G8"
FT                   /transl_table=1
FT                   /translation="MASKRSHVFRVTGLSRELLDEDLKTTLQETIADKFADDERSHIKA
FT                   EITIVPSCYESDTQRVALVQFRGGVPQFLRELRVDQLGDWQIEMGDDDINFDCHFFGFT
FT                   QLYTPDKNEPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGYN
FT                   SKLSSPGVNTILDYGRELMEDIKKVRTTKQLQQRPLIFIAHSFGGIILAHCLVRAIQTL
FT                   EEDHPAITSLHRATYGIILFAIPHKGLVMDDIQQMLGGDGHHPRETLLRQISSQSDVLI
FT                   HQLADFKNLIRDRKVVSFYETEQTKRLVLDSESGRWKRTGDFMTTVDADSALLQLPDHV
FT                   EDKVPLHADHSMIVKFDMRNAVGYRTALDKLRQFSKKAPSVVAARFNASNAPTTLLHES
FT                   SVRKRNIMDDDSETPKAKRARLHDSASSSNSEESDTAHYEDDNISDDISQVKVYNINEP
FT                   SEESHNGFSESLIARDATSEIGSSFRYGSSSWEGSFSENGLADGSDILEPDELSSSGES
FT                   ISSGC"
     MASKRSHVFR VTGLSRELLD EDLKTTLQET IADKFADDER SHIKAEITIV PSCYESDTQR        60
     VALVQFRGGV PQFLRELRVD QLGDWQIEMG DDDINFDCHF FGFTQLYTPD KNEPVIADII       120
     AIAGLDGHAY GSWQGRGNLG RMWLRDFLSK DLPQCRTMIY GYNSKLSSPG VNTILDYGRE       180
     LMEDIKKVRT TKQLQQRPLI FIAHSFGGII LAHCLVRAIQ TLEEDHPAIT SLHRATYGII       240
     LFAIPHKGLV MDDIQQMLGG DGHHPRETLL RQISSQSDVL IHQLADFKNL IRDRKVVSFY       300
     ETEQTKRLVL DSESGRWKRT GDFMTTVDAD SALLQLPDHV EDKVPLHADH SMIVKFDMRN       360
     AVGYRTALDK LRQFSKKAPS VVAARFNASN APTTLLHESS VRKRNIMDDD SETPKAKRAR       420
     LHDSASSSNS EESDTAHYED DNISDDISQV KVYNINEPSE ESHNGFSESL IARDATSEIG       480
     SSFRYGSSSW EGSFSENGLA DGSDILEPDE LSSSGESISS GC                          522
//

If you have problems or comments...

PBIL Back to PBIL home page