(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE190

PENCW_10.PE190       Location/Qualifiers
FT   CDS             join(440999..441730,441788..442471,442526..442873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949813"
FT                   /orf_name="Pc13g01900"
FT                   /product="Pc13g01900 protein"
FT                   /protein_id="CAP91259.1"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001830905"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B0"
FT                   /transl_table=1
FT                   /translation="MHRLREAGRCPSAAPSETSGSTSPERAADDDTDFFMAQANDSQSS
FT                   IGVANFRDSRLSSEPSEPLPPIGRLPPEILIAIFSKLAAPLDMLNSMLVCRGWAANSVG
FT                   ILWHRPTCNTWANVRSVTTSLGKPDSLFNYADLIKRLNLSALSDDVSDGTILSFNQCKR
FT                   IERLTLTSCKNLTDKGVSDLVEGNRHLQALDVSDLRHLTDHTLATVSRDCPRLQGLNIT
FT                   GCSKVTDDALLIVSQKCRQIKRLKLNGVSNVSDRAIQSFAENCPSILEIDLHDCKLVTS
FT                   ASVTPLLTTLRHLRELRLAHCTELDDTAFLSLPPQVTFDSLRILDLTACENVRDDSVER
FT                   IVRAAPRLRNLVLAKCRFITDRSVMAICRLGKNLHYVHLGHCSNITDSAVISLVKSCNR
FT                   IRYIDLACCNLLTDRSVQQLATLPKLRRIGLVKCQAITDQSILALARPKIGHHPSVSSL
FT                   ERVHLSYCVQLRMKGIHALLNSCPRLTHLSLTGVQEFLRENLTVFCREAPPEFTQQQRD
FT                   VFCVFSGDGVNRLRDHLNRHEPQFQEEAEATMYDDDEELDEDEGQMTGLMNATVINDGD
FT                   DDYIDVGPLNT"
     MHRLREAGRC PSAAPSETSG STSPERAADD DTDFFMAQAN DSQSSIGVAN FRDSRLSSEP        60
     SEPLPPIGRL PPEILIAIFS KLAAPLDMLN SMLVCRGWAA NSVGILWHRP TCNTWANVRS       120
     VTTSLGKPDS LFNYADLIKR LNLSALSDDV SDGTILSFNQ CKRIERLTLT SCKNLTDKGV       180
     SDLVEGNRHL QALDVSDLRH LTDHTLATVS RDCPRLQGLN ITGCSKVTDD ALLIVSQKCR       240
     QIKRLKLNGV SNVSDRAIQS FAENCPSILE IDLHDCKLVT SASVTPLLTT LRHLRELRLA       300
     HCTELDDTAF LSLPPQVTFD SLRILDLTAC ENVRDDSVER IVRAAPRLRN LVLAKCRFIT       360
     DRSVMAICRL GKNLHYVHLG HCSNITDSAV ISLVKSCNRI RYIDLACCNL LTDRSVQQLA       420
     TLPKLRRIGL VKCQAITDQS ILALARPKIG HHPSVSSLER VHLSYCVQLR MKGIHALLNS       480
     CPRLTHLSLT GVQEFLRENL TVFCREAPPE FTQQQRDVFC VFSGDGVNRL RDHLNRHEPQ       540
     FQEEAEATMY DDDEELDEDE GQMTGLMNAT VINDGDDDYI DVGPLNT                     587
//

If you have problems or comments...

PBIL Back to PBIL home page